Result : B3QSH6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L21 |
| NCBI Accession ID | CP001100.1 |
| Organism | Chloroherpeton thalassium (strain ATCC 35110 / GB-78) |
| Left | 113535 |
| Right | 113831 |
| Strand | + |
| Nucleotide Sequence | ATGCGGGCTCTTGTAGAAATTTCTGATAAACAGTTTTTTGTAACGGAAGGCGAAAAGCTTTTTGTTCCGACACAAAAAGCAGAAGCAGGCGACACCCTGACTTTTGAAAAAGTGCTTTTACAAAGCGACGGCGCGGCAGCAAGCCTTTCTCCGTCGTGCAAAGTAACAGCAAAACTTCTGCGCCACATTAAAGGCGATAAAGTTACCGTTTTTAAGAAGAAACGCCGTAAGCGCTACCGTGTAACACGCGGGCATCGCCAAGGATTCTCAGAAATTGAAATCCTTTCCGTTGCTTAA |
| Sequence | MRALVEISDKQFFVTEGEKLFVPTQKAEAGDTLTFEKVLLQSDGAAASLSPSCKVTAKLLRHIKGDKVTVFKKKRRKRYRVTRGHRQGFSEIEILSVA |
| Source of smORF | Swiss-Prot |
| Function | This protein binds to 23S rRNA in the presence of protein L20. {ECO:0000255|HAMAP-Rule:MF_01363}. |
| Pubmed ID | |
| Domain | CDD:412347 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B3QSH6 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 113535 | 113831 | + | NC_011026.1 | Chloroherpeton thalassium ATCC 35110 |
| 2 | 1746019 | 1746309 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 3 | 1698152 | 1698442 | + | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 4 | 1883976 | 1884266 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 5 | 2206037 | 2206327 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 6 | 2427747 | 2428055 | - | NC_017464.1 | Ignavibacterium album JCM 16511 |
| 7 | 1905320 | 1905631 | - | NC_015510.1 | Haliscomenobacter hydrossis DSM 1100 |
| 8 | 2777904 | 2778209 | + | NC_016940.1 | Saprospira grandis str. Lewin |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011026.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00488.23 | 0.62 | 5 | 698 | opposite-strand | MutS domain V |
| 2 | PF01624.22 | 0.62 | 5 | 698 | opposite-strand | MutS domain I |
| 3 | PF05188.19 | 0.62 | 5 | 698 | opposite-strand | MutS domain II |
| 4 | PF01016.21 | 1.0 | 8 | 39.0 | same-strand | Ribosomal L27 protein |
| 5 | PF00056.25 | 0.75 | 6 | 451.5 | same-strand | lactate/malate dehydrogenase, NAD binding domain |
| 6 | PF02866.20 | 0.75 | 6 | 451.5 | same-strand | lactate/malate dehydrogenase, alpha/beta C-terminal domain |
++ More..