Result : EXP02166
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02166 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 4789615 |
| Right | 4789713 |
| Strand | - |
| Nucleotide Sequence | GTGTTATTAATCTGCCTATTATTTTATATACCCTTCCTACTTCAAGTGGCTTATGTGTTGGCTACGGATTACCCGGCCCATCCATGGGCCTCGCCCTGA |
| Sequence | VLLICLLFYIPFLLQVAYVLATDYPAHPWASP |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4769050 | 4769148 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 4519560 | 4519655 | + | NZ_CP060111.1 | Klebsiella michiganensis |
| 3 | 2557666 | 2557767 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03466.22 | 0.67 | 2 | 4426.0 | both-strands | LysR substrate binding domain |
| 2 | PF00126.29 | 0.67 | 2 | 4426.0 | both-strands | Bacterial regulatory helix-turn-helix protein, lysR family |
| 3 | PF07690.18 | 0.67 | 2 | 1093 | same-strand | Major Facilitator Superfamily |
++ More..