Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02166 |
NCBI Accession ID | NC_016810.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
Left | 4789615 |
Right | 4789713 |
Strand | - |
Nucleotide Sequence | GTGTTATTAATCTGCCTATTATTTTATATACCCTTCCTACTTCAAGTGGCTTATGTGTTGGCTACGGATTACCCGGCCCATCCATGGGCCTCGCCCTGA |
Sequence | VLLICLLFYIPFLLQVAYVLATDYPAHPWASP |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | Venturini et al 2020 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 32 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4769050 | 4769148 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 4519560 | 4519655 | + | NZ_CP060111.1 | Klebsiella michiganensis |
3 | 2557666 | 2557767 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03466.22 | 0.67 | 2 | 4426.0 | both-strands | LysR substrate binding domain |
2 | PF00126.29 | 0.67 | 2 | 4426.0 | both-strands | Bacterial regulatory helix-turn-helix protein, lysR family |
3 | PF07690.18 | 0.67 | 2 | 1093 | same-strand | Major Facilitator Superfamily |