Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02155 |
NCBI Accession ID | NC_016810.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
Left | 3593698 |
Right | 3593850 |
Strand | - |
Nucleotide Sequence | ATGAAAAATCAACAAACAGAAAAAAAGATCCAAAAAACGCTTGTGCAAAAAAATGGGATCCCTATAATGCGCCTCCATCGACACGGCGGATGTGAATCACTTCACACAAACAGCCGGTCGGTTGAAGAGAAAAATCCTGAAATTCAGGGTTGA |
Sequence | MKNQQTEKKIQKTLVQKNGIPIMRLHRHGGCESLHTNSRSVEEKNPEIQG |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | Venturini et al 2020 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 50 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3572223 | 3572375 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 1422349 | 1422501 | - | NZ_CP053416.1 | Salmonella bongori |
3 | 411828 | 411980 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF08361.13 | 0.67 | 2 | 11420.5 | same-strand | MAATS-type transcriptional repressor, C-terminal region |
2 | PF00440.25 | 0.67 | 2 | 11420.5 | same-strand | Bacterial regulatory proteins, tetR family |
3 | PF16576.7 | 0.67 | 2 | 9855.5 | opposite-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
4 | PF00529.22 | 0.67 | 2 | 9855.5 | opposite-strand | Cation efflux system protein CusB domain 1 |
5 | PF13437.8 | 0.67 | 2 | 9855.5 | opposite-strand | HlyD family secretion protein |
6 | PF13533.8 | 0.67 | 2 | 9855.5 | opposite-strand | Biotin-lipoyl like |
7 | PF00873.21 | 0.67 | 2 | 6730.5 | opposite-strand | AcrB/AcrD/AcrF family |
8 | PF00132.26 | 1.0 | 3 | 114 | opposite-strand | Bacterial transferase hexapeptide (six repeats) |
9 | PF14602.8 | 1.0 | 3 | 114 | opposite-strand | Hexapeptide repeat of succinyl-transferase |
10 | PF07369.13 | 1.0 | 3 | 644 | same-strand | Protein of unknown function (DUF1488) |
11 | PF08501.13 | 1.0 | 3 | 898 | same-strand | Shikimate dehydrogenase substrate binding domain |
12 | PF18317.3 | 1.0 | 3 | 898 | same-strand | Shikimate 5'-dehydrogenase C-terminal domain |
13 | PF01300.20 | 1.0 | 3 | 1721 | same-strand | Telomere recombination |
14 | PF01396.21 | 1.0 | 3 | 2286 | same-strand | Topoisomerase DNA binding C4 zinc finger |