Result : EXP02155
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02155 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 3593698 |
| Right | 3593850 |
| Strand | - |
| Nucleotide Sequence | ATGAAAAATCAACAAACAGAAAAAAAGATCCAAAAAACGCTTGTGCAAAAAAATGGGATCCCTATAATGCGCCTCCATCGACACGGCGGATGTGAATCACTTCACACAAACAGCCGGTCGGTTGAAGAGAAAAATCCTGAAATTCAGGGTTGA |
| Sequence | MKNQQTEKKIQKTLVQKNGIPIMRLHRHGGCESLHTNSRSVEEKNPEIQG |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 50 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3572223 | 3572375 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 1422349 | 1422501 | - | NZ_CP053416.1 | Salmonella bongori |
| 3 | 411828 | 411980 | + | NZ_CP054058.1 | Scandinavium goeteborgense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08361.13 | 0.67 | 2 | 11420.5 | same-strand | MAATS-type transcriptional repressor, C-terminal region |
| 2 | PF00440.25 | 0.67 | 2 | 11420.5 | same-strand | Bacterial regulatory proteins, tetR family |
| 3 | PF16576.7 | 0.67 | 2 | 9855.5 | opposite-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 4 | PF00529.22 | 0.67 | 2 | 9855.5 | opposite-strand | Cation efflux system protein CusB domain 1 |
| 5 | PF13437.8 | 0.67 | 2 | 9855.5 | opposite-strand | HlyD family secretion protein |
| 6 | PF13533.8 | 0.67 | 2 | 9855.5 | opposite-strand | Biotin-lipoyl like |
| 7 | PF00873.21 | 0.67 | 2 | 6730.5 | opposite-strand | AcrB/AcrD/AcrF family |
| 8 | PF00132.26 | 1.0 | 3 | 114 | opposite-strand | Bacterial transferase hexapeptide (six repeats) |
| 9 | PF14602.8 | 1.0 | 3 | 114 | opposite-strand | Hexapeptide repeat of succinyl-transferase |
| 10 | PF07369.13 | 1.0 | 3 | 644 | same-strand | Protein of unknown function (DUF1488) |
| 11 | PF08501.13 | 1.0 | 3 | 898 | same-strand | Shikimate dehydrogenase substrate binding domain |
| 12 | PF18317.3 | 1.0 | 3 | 898 | same-strand | Shikimate 5'-dehydrogenase C-terminal domain |
| 13 | PF01300.20 | 1.0 | 3 | 1721 | same-strand | Telomere recombination |
| 14 | PF01396.21 | 1.0 | 3 | 2286 | same-strand | Topoisomerase DNA binding C4 zinc finger |
++ More..