Result : EXP02137
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02137 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 1979847 |
| Right | 1979990 |
| Strand | - |
| Nucleotide Sequence | GTGAACATTAGGTTATTAATTAAACAAAGTAAAAGCCATGCTGATGGTTTTATCGTAAGTATTCCGTTAAAATATGTGATCTGCATCACATATTTTCTAAAATCGCCGTCCCGCTCCGTTGTATGTCACGAAGCTGACGAGTAG |
| Sequence | VNIRLLIKQSKSHADGFIVSIPLKYVICITYFLKSPSRSVVCHEADE |
| Source of smORF | Transcriptional-level |
| Function | It is induced when bacteria are grown under SPI-1 conditions. (infection relevant conditions) Pubmed:Venturini_et_al_2020 |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2022277 | 2022420 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 686679 | 686825 | - | NZ_CP033744.1 | Citrobacter freundii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01584.21 | 1.0 | 2 | 3086.0 | same-strand | CheW-like domain |
| 2 | PF09078.13 | 1.0 | 2 | 3086.0 | same-strand | CheY binding |
| 3 | PF01627.25 | 1.0 | 2 | 3086.0 | same-strand | Hpt domain |
| 4 | PF02518.28 | 1.0 | 2 | 3086.0 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 5 | PF02895.16 | 1.0 | 2 | 3086.0 | same-strand | Signal transducing histidine kinase, homodimeric domain |
| 6 | PF13677.8 | 1.0 | 2 | 2152.0 | same-strand | Membrane MotB of proton-channel complex MotA/MotB |
| 7 | PF00691.22 | 1.0 | 2 | 2152.0 | same-strand | OmpA family |
| 8 | PF01618.18 | 1.0 | 2 | 1268.0 | same-strand | MotA/TolQ/ExbB proton channel family |
| 9 | PF05280.13 | 1.0 | 2 | 563.5 | same-strand | Flagellar transcriptional activator (FlhC) |
| 10 | PF05247.15 | 1.0 | 2 | 221.0 | same-strand | Flagellar transcriptional activator (FlhD) |
| 11 | PF00582.28 | 1.0 | 2 | 429.5 | opposite-strand | Universal stress protein family |
| 12 | PF00982.23 | 1.0 | 2 | 875.5 | same-strand | Glycosyltransferase family 20 |
| 13 | PF02358.18 | 1.0 | 2 | 2271.5 | same-strand | Trehalose-phosphatase |
++ More..