Result : EXP02135
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02135 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 1803657 |
| Right | 1803755 |
| Strand | - |
| Nucleotide Sequence | ATGAATTTTAACGGCATAATTTGTGAAGGAATGTGTATATACCCTTCATACTTCAAGTTGCTTATGTGTTGGCTACGCTCGCTCACCCCAGTCACATAG |
| Sequence | MNFNGIICEGMCIYPSYFKLLMCWLRSLTPVT |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 14
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1846798 | 1846896 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 87356 | 87454 | + | NZ_CP036175.1 | Klebsiella huaxiensis |
| 3 | 998461 | 998541 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 4 | 462048 | 462131 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 5 | 3355601 | 3355699 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 6 | 1437532 | 1437627 | - | NC_012962.1 | Photorhabdus asymbiotica |
| 7 | 2980932 | 2981012 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 8 | 3689630 | 3689734 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 9 | 5618602 | 5618712 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 10 | 2615125 | 2615223 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 11 | 2712027 | 2712128 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 12 | 2355733 | 2355828 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 13 | 1953394 | 1953474 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 14 | 483927 | 484016 | + | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 15 | 3048772 | 3048855 | - | NC_005126.1 | Photorhabdus laumondii subsp. laumondii TTO1 |
| 16 | 3854196 | 3854300 | + | NZ_CP060401.1 | Xenorhabdus nematophila |
| 17 | 2181666 | 2181758 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 18 | 1599118 | 1599207 | + | NZ_CP031961.1 | Pseudoalteromonas tunicata |
| 19 | 357475 | 357564 | + | NZ_CP022742.1 | Vibrio qinghaiensis |
| 20 | 804111 | 804203 | + | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 21 | 4087476 | 4087571 | - | NZ_AP023184.1 | Buttiauxella agrestis |
| 22 | 1212169 | 1212276 | + | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 23 | 4377441 | 4377554 | - | NZ_CP025799.1 | Dickeya zeae |
| 24 | 146325 | 146432 | - | NZ_CP007230.1 | Yersinia similis |
| 25 | 1319137 | 1319238 | - | NZ_LT556085.1 | Citrobacter amalonaticus |
++ More..