Result : B3PY50
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | NADH-quinone oxidoreductase subunit K 2 (EC 7.1.1.-) (NADH dehydrogenase I subunit K 2) (NDH-1 subunit K 2) |
| NCBI Accession ID | CP001074.1 |
| Organism | Rhizobium etli (strain CIAT 652) |
| Left | 3656637 |
| Right | 3656939 |
| Strand | + |
| Nucleotide Sequence | ATGGTTCCGCTCTGGTGGTTTATTGTGCTCGGAGTGGTCCTGTTCGTGATCGGAGCAGCGGGCGTACTGCTCAGGCGCAATATTCTGGTGGTGCTCATGTCGCTGGAACTTTTGCTCAACTCGGTCAACATCAACTTCATCGCTTTCGGGCATTACTACGATGATTTCCGCGGGCAGATCTTCGCGATCTTCGTCATCGCAATCACCGCGGCGGAGGTCGCCGTCGCCCTCGGTATCCTGGTCGCCCTTGTGAGGAACAAGTCCACCCTCAAGGTCGACGACGTGACCATGCTGAAAGGATAG |
| Sequence | MVPLWWFIVLGVVLFVIGAAGVLLRRNILVVLMSLELLLNSVNINFIAFGHYYDDFRGQIFAIFVIAITAAEVAVALGILVALVRNKSTLKVDDVTMLKG |
| Source of smORF | Swiss-Prot |
| Function | NDH-1 shuttles electrons from NADH, via FMN and iron-sulfur (Fe-S) centers, to quinones in the respiratory chain. The immediate electron acceptor for the enzyme in this species is believed to be ubiquinone. Couples the redox reaction to proton translocation (for every two electrons transferred, four hydrogen ions are translocated across the cytoplasmic membrane), and thus conserves the redox energy in a proton gradient. {ECO:0000255|HAMAP-Rule:MF_01456}. |
| Pubmed ID | |
| Domain | CDD:412408 |
| Functional Category | Others |
| Uniprot ID | B3PY50 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 72
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3622126 | 3622428 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 2 | 3868206 | 3868508 | + | NZ_CP020906.1 | Rhizobium etli |
| 3 | 6207609 | 6207911 | + | NZ_CP039690.1 | Phreatobacter stygius |
| 4 | 421036 | 421338 | - | NZ_CP017942.1 | Phyllobacterium zundukense |
| 5 | 4038914 | 4039216 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 6 | 3657990 | 3658292 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 7 | 472022 | 472324 | - | NZ_CP054027.1 | Rhizobium hidalgonense |
| 8 | 851979 | 852281 | - | NC_020527.1 | Sinorhizobium meliloti 2011 |
| 9 | 3535694 | 3535996 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 10 | 540399 | 540701 | + | NZ_CP032695.1 | Rhizobium jaguaris |
| 11 | 697499 | 697801 | - | NZ_CP071455.1 | Rhizobium lentis |
| 12 | 1896641 | 1896943 | - | NZ_CP023068.1 | Ensifer sojae CCBAU 05684 |
| 13 | 2581056 | 2581358 | - | NZ_CP013107.1 | Sinorhizobium americanum |
| 14 | 840900 | 841202 | + | NZ_CP006880.1 | Rhizobium gallicum bv. gallicum R602sp |
| 15 | 728238 | 728540 | + | NZ_CP034910.1 | Ensifer alkalisoli |
| 16 | 2468516 | 2468818 | - | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 17 | 52060 | 52362 | + | NZ_CP015882.1 | Ensifer adhaerens |
| 18 | 200911 | 201213 | + | NZ_CP041241.1 | Ensifer mexicanus |
| 19 | 3220785 | 3221087 | - | NZ_CP054021.1 | Rhizobium indicum |
| 20 | 1049551 | 1049853 | + | NZ_CP033219.1 | Parasedimentitalea marina |
| 21 | 1367291 | 1367593 | + | NZ_LS483250.1 | Moritella yayanosii |
| 22 | 1914974 | 1915276 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 23 | 1812455 | 1812757 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 24 | 1673596 | 1673877 | + | NZ_CP017754.1 | Cupriavidus malaysiensis |
| 25 | 5335022 | 5335267 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 26 | 5284723 | 5284980 | - | NZ_CP063849.1 | Paludibaculum fermentans |
| 27 | 1715366 | 1715668 | - | NC_017094.1 | Leptospirillum ferrooxidans C2-3 |
| 28 | 981737 | 981988 | + | NZ_LR778301.1 | Denitratisoma oestradiolicum |
| 29 | 2875608 | 2875913 | + | NC_006513.1 | Aromatoleum aromaticum EbN1 |
| 30 | 699128 | 699433 | - | NZ_CP059467.1 | Aromatoleum bremense |
| 31 | 3351375 | 3351623 | - | NZ_CP064781.1 | Azospira restricta |
| 32 | 1155702 | 1155983 | + | NZ_CP039287.1 | Cupriavidus necator H16 |
| 33 | 414564 | 414869 | - | NZ_CP009555.1 | Burkholderia oklahomensis C6786 |
| 34 | 2192325 | 2192576 | - | NC_007947.1 | Methylobacillus flagellatus KT |
| 35 | 1229459 | 1229707 | + | NZ_CP022579.1 | Oryzomicrobium terrae |
| 36 | 1549235 | 1549534 | - | NZ_LT828648.1 | Nitrospira japonica |
| 37 | 943844 | 944164 | + | NZ_CP034940.1 | Halorubrum ezzemoulense |
| 38 | 1361797 | 1362048 | + | NZ_AP021884.1 | Sulfuriferula plumbiphila |
| 39 | 535793 | 536062 | - | NZ_CP011257.1 | Ralstonia mannitolilytica |
| 40 | 4705443 | 4705727 | - | NZ_CP023422.1 | Janthinobacterium svalbardensis |
| 41 | 2397033 | 2397341 | - | NZ_CP041185.1 | Janthinobacterium tructae |
| 42 | 1292537 | 1292818 | + | NZ_CP062803.1 | Cupriavidus basilensis |
| 43 | 1268156 | 1268437 | - | NZ_CP035900.1 | Burkholderia glumae |
| 44 | 3187114 | 3187395 | - | NZ_CP002580.1 | Burkholderia plantarii |
| 45 | 632430 | 632735 | - | NZ_AP019755.1 | Nitrosomonas stercoris |
| 46 | 723722 | 723985 | + | NC_012029.1 | Halorubrum lacusprofundi ATCC 49239 |
| 47 | 1013399 | 1013680 | + | NZ_CP032519.1 | Cupriavidus oxalaticus |
| 48 | 4023778 | 4024077 | - | NC_020520.1 | Ilumatobacter coccineus YM16-304 |
| 49 | 2376829 | 2377104 | + | NZ_AP017558.1 | Halopenitus persicus |
| 50 | 958028 | 958333 | + | NC_008344.1 | Nitrosomonas eutropha C91 |
| 51 | 876335 | 876640 | - | NZ_CP011451.1 | Nitrosomonas communis |
| 52 | 1912784 | 1913089 | - | NC_004757.1 | Nitrosomonas europaea ATCC 19718 |
| 53 | 1012722 | 1012970 | + | NZ_AP018907.1 | Blastochloris tepida |
| 54 | 1228916 | 1229197 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 55 | 703381 | 703668 | - | NC_005125.1 | Gloeobacter violaceus PCC 7421 |
| 56 | 709749 | 710012 | - | NZ_CP071463.1 | Haloterrigena longa |
| 57 | 822295 | 822564 | - | NZ_CP007055.1 | Halostagnicola larsenii XH-48 |
| 58 | 2311778 | 2312029 | - | NZ_CP028901.1 | Algicoccus marinus |
| 59 | 226869 | 227171 | + | NZ_LR698974.1 | Candidatus Methanomassiliicoccus intestinalis |
| 60 | 4035252 | 4035503 | - | NZ_AP019312.1 | Chromobacterium haemolyticum |
| 61 | 1056699 | 1056947 | + | NC_013959.1 | Sideroxydans lithotrophicus ES-1 |
| 62 | 1832314 | 1832568 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 63 | 2195938 | 2196225 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 64 | 1411073 | 1411393 | - | NC_009441.1 | Flavobacterium johnsoniae UW101 |
| 65 | 706607 | 706855 | + | NZ_CP020918.1 | Flavobacterium faecale |
| 66 | 1613755 | 1614030 | + | NZ_CP016907.1 | Flavobacterium anhuiense |
| 67 | 1458263 | 1458538 | + | NZ_CP043612.1 | Flavobacterium nitrogenifigens |
| 68 | 1343410 | 1343685 | - | NZ_CP029255.1 | Flavobacterium crocinum |
| 69 | 1268586 | 1268906 | - | NZ_CP017479.1 | Flavobacterium gilvum |
| 70 | 2331277 | 2331597 | + | NZ_CP037933.1 | Flavobacterium nackdongense |
| 71 | 7543471 | 7543764 | - | NZ_CP012752.1 | Kibdelosporangium phytohabitans |
| 72 | 2387608 | 2387871 | + | NC_020388.1 | Natronomonas moolapensis 8.8.11 |
| 73 | 3760460 | 3760729 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022873.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00499.22 | 0.9 | 65 | 30.0 | same-strand | NADH-ubiquinone/plastoquinone oxidoreductase chain 6 |
| 2 | PF00361.22 | 0.99 | 71 | 2050.0 | same-strand | Proton-conducting membrane transporter |
| 3 | PF00662.22 | 0.99 | 71 | 7.0 | same-strand | NADH-Ubiquinone oxidoreductase (complex I), chain 5 N-terminus |
| 4 | PF00146.23 | 0.71 | 51 | 1220.5 | same-strand | NADH dehydrogenase |
| 5 | PF00037.29 | 0.72 | 52 | 689 | same-strand | 4Fe-4S binding domain |
| 6 | PF12838.9 | 0.72 | 52 | 692 | same-strand | 4Fe-4S dicluster domain |
| 7 | PF13187.8 | 0.72 | 52 | 692.0 | same-strand | 4Fe-4S dicluster domain |
| 8 | PF13237.8 | 0.68 | 49 | 695.5 | same-strand | 4Fe-4S dicluster domain |
++ More..