Result : A0RQF4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
| NCBI Accession ID | CP000487.1 |
| Organism | Campylobacter fetus subsp. fetus (strain 82-40) |
| Left | 1273104 |
| Right | 1273406 |
| Strand | + |
| Nucleotide Sequence | ATGAAAAAAGTTCTTTTTCTTGTAGTAGCTTTAGCAAGTTTTGCTTTTGGTGCCGATGGCGAACAAATCAAAGCATTTTCAGTTGTAGCAGCCGGCATCGGTCTTGGTGTTGCGGCACTTGGTGGAGCTATCGGTATGGGACATACTGCAGCAGCAACTATCCTTGGAACAGCTAGAAACCCAGGTCTTGGCGGAAAGCTTTTAACTACGATGTTTATCGCTCTTGCGATGATCGAAGCGCAAGTTATCTATGCACTTGTTATCGCTCTTATCGCACTTTACGCTAACCCATTTTTAGGTTAA |
| Sequence | MKKVLFLVVALASFAFGADGEQIKAFSVVAAGIGLGVAALGGAIGMGHTAAATILGTARNPGLGGKLLTTMFIALAMIEAQVIYALVIALIALYANPFLG |
| Source of smORF | Swiss-Prot |
| Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
| Pubmed ID | |
| Domain | CDD:412393 |
| Functional Category | Others |
| Uniprot ID | A0RQF4 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 78
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1279910 | 1280212 | + | NZ_CP059443.1 | Campylobacter fetus |
| 2 | 1398646 | 1398948 | + | NZ_CP010995.1 | Campylobacter iguaniorum |
| 3 | 504128 | 504430 | - | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 4 | 1109519 | 1109821 | - | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 5 | 726454 | 726756 | - | NZ_CP019684.1 | Campylobacter sputorum bv. paraureolyticus LMG 11764 |
| 6 | 775194 | 775496 | + | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 7 | 746939 | 747241 | + | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 8 | 852472 | 852771 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 9 | 1426001 | 1426345 | + | NZ_CP021886.1 | Helicobacter apodemus |
| 10 | 114157 | 114462 | - | NZ_CP063087.1 | Helicobacter winghamensis |
| 11 | 1263217 | 1263540 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 12 | 1220681 | 1221004 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 13 | 1450760 | 1451083 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 14 | 1157204 | 1157527 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 15 | 773790 | 774116 | - | NZ_CP022347.1 | Campylobacter avium LMG 24591 |
| 16 | 490207 | 490509 | - | NZ_CP012541.1 | Campylobacter concisus |
| 17 | 1661304 | 1661618 | - | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 18 | 282649 | 282972 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 19 | 1144020 | 1144343 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 20 | 618149 | 618451 | + | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 21 | 872516 | 872854 | + | NC_002163.1 | Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819 |
| 22 | 559079 | 559381 | - | NZ_CP053826.1 | Campylobacter curvus |
| 23 | 1421798 | 1422115 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 24 | 571785 | 572096 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 25 | 588301 | 588603 | + | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 26 | 1121141 | 1121401 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 27 | 567498 | 567800 | - | NZ_CP053831.1 | Campylobacter mucosalis |
| 28 | 583777 | 584076 | - | NZ_CP012544.1 | Campylobacter showae |
| 29 | 522504 | 522803 | - | NZ_CP012543.1 | Campylobacter rectus |
| 30 | 338394 | 338732 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 31 | 1001259 | 1001591 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 32 | 443524 | 443823 | - | NZ_CP031611.1 | Campylobacter hepaticus |
| 33 | 277316 | 277627 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 34 | 480841 | 481185 | + | NZ_CP053842.1 | Campylobacter corcagiensis |
| 35 | 431999 | 432313 | + | NC_007575.1 | Sulfurimonas denitrificans DSM 1251 |
| 36 | 1763537 | 1763851 | - | NC_014506.1 | Sulfurimonas autotrophica DSM 16294 |
| 37 | 1383259 | 1383576 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 38 | 893023 | 893328 | - | NZ_CP027432.2 | Caminibacter pacificus |
| 39 | 1801558 | 1801872 | + | NZ_CP054051.1 | Aliarcobacter cibarius |
| 40 | 2105362 | 2105676 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 41 | 2342861 | 2343175 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 42 | 948798 | 949103 | + | NC_012115.1 | Nautilia profundicola AmH |
| 43 | 893080 | 893391 | - | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 44 | 837789 | 838103 | - | NC_014166.1 | Arcobacter nitrofigilis DSM 7299 |
| 45 | 1736900 | 1737211 | + | NZ_CP053837.1 | Aliarcobacter faecis |
| 46 | 813784 | 814098 | - | NZ_CP041070.1 | Arcobacter anaerophilus |
| 47 | 1639669 | 1639983 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 48 | 1276407 | 1276652 | - | NC_017379.1 | Helicobacter pylori Puno135 |
| 49 | 1988240 | 1988554 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 50 | 1979352 | 1979657 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 51 | 1903974 | 1904279 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 52 | 1439072 | 1439383 | + | NZ_CP036246.2 | [Arcobacter] porcinus |
| 53 | 529114 | 529419 | + | NZ_CP063164.1 | Sulfurovum indicum |
| 54 | 409863 | 410168 | + | NZ_AP022826.1 | Nitrosophilus labii |
| 55 | 402197 | 402502 | + | NZ_AP022847.1 | Nitrosophilus alvini |
| 56 | 2072185 | 2072502 | - | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 57 | 1014956 | 1015261 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 58 | 474936 | 475244 | + | NC_014935.1 | Nitratifractor salsuginis DSM 16511 |
| 59 | 569675 | 569980 | + | NZ_CP011308.1 | Sulfurovum lithotrophicum |
| 60 | 676430 | 676744 | - | NZ_CP032098.1 | Malaciobacter molluscorum LMG 25693 |
| 61 | 2276014 | 2276328 | + | NZ_CP042652.1 | Pseudoarcobacter acticola |
| 62 | 1914864 | 1915172 | + | NZ_CP035946.1 | Campylobacter canadensis |
| 63 | 1214361 | 1214681 | - | NZ_CP012547.1 | Campylobacter pinnipediorum subsp. pinnipediorum |
| 64 | 511971 | 512309 | + | NZ_CP053841.1 | Campylobacter blaseri |
| 65 | 776086 | 776379 | - | NZ_CP042812.1 | Malaciobacter canalis |
| 66 | 782339 | 782632 | - | NZ_CP032101.1 | Malaciobacter marinus |
| 67 | 714576 | 714890 | - | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 68 | 594063 | 594377 | + | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 69 | 1353148 | 1353462 | - | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 70 | 2422080 | 2422373 | + | NZ_CP053840.1 | Arcobacter venerupis |
| 71 | 1884243 | 1884536 | + | NZ_CP031217.1 | Halarcobacter bivalviorum |
| 72 | 721327 | 721620 | - | NZ_CP031218.1 | Malaciobacter halophilus |
| 73 | 1531840 | 1532178 | - | NZ_CP012196.1 | Campylobacter gracilis |
| 74 | 622685 | 622990 | - | NZ_CP035928.1 | Malaciobacter pacificus |
| 75 | 766664 | 766957 | - | NZ_CP019070.1 | Poseidonibacter parvus |
| 76 | 1007626 | 1007931 | - | NZ_CP040463.1 | Caminibacter mediatlanticus TB-2 |
| 77 | 4338242 | 4338502 | + | NZ_AP023213.1 | Citrifermentans bremense |
| 78 | 4469725 | 4469985 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
++ More..