Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02125 |
NCBI Accession ID | NC_016810.1 |
Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
Left | 174883 |
Right | 174981 |
Strand | - |
Nucleotide Sequence | GTGCTTTCTTTTTACGCAACTCGTCATCACCCCTGCACAAAGCAGGTGCATTCGCGGCCACATACCATTATTCTGATCAAGACGAAAGAGTTGAAGTGA |
Sequence | VLSFYATRHHPCTKQVHSRPHTIILIKTKELK |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | Venturini et al 2020 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 32 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 174879 | 174977 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
2 | 2762667 | 2762759 | - | NZ_CP053416.1 | Salmonella bongori |
3 | 3677070 | 3677168 | - | NZ_CP057657.1 | Escherichia fergusonii |
4 | 4276278 | 4276370 | + | NZ_LR134475.1 | Klebsiella aerogenes |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01510.27 | 1.0 | 4 | 4971.0 | opposite-strand | N-acetylmuramoyl-L-alanine amidase |
2 | PF17113.7 | 1.0 | 4 | 4120.0 | opposite-strand | Regulatory signalling modulator protein AmpE |
3 | PF04616.16 | 0.75 | 3 | 3087 | same-strand | Glycosyl hydrolases family 43 |
4 | PF13347.8 | 0.75 | 3 | 1681 | same-strand | MFS/sugar transport protein |
5 | PF07690.18 | 0.75 | 3 | 1681 | same-strand | Major Facilitator Superfamily |
6 | PF00324.23 | 1.0 | 4 | 147.0 | same-strand | Amino acid permease |
7 | PF13520.8 | 1.0 | 4 | 147.0 | same-strand | Amino acid permease |
8 | PF00392.23 | 0.75 | 3 | 339 | opposite-strand | Bacterial regulatory proteins, gntR family |
9 | PF07729.14 | 0.75 | 3 | 339 | opposite-strand | FCD domain |
10 | PF17831.3 | 0.75 | 3 | 1261 | opposite-strand | Pyruvate dehydrogenase E1 component middle domain |
11 | PF00198.25 | 0.75 | 3 | 3939 | opposite-strand | 2-oxoacid dehydrogenases acyltransferase (catalytic domain) |
12 | PF00364.24 | 0.75 | 3 | 3939 | opposite-strand | Biotin-requiring enzyme |
13 | PF02817.19 | 0.75 | 3 | 3939 | opposite-strand | e3 binding domain |
14 | PF07992.16 | 0.75 | 3 | 6030 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |
15 | PF02852.24 | 0.75 | 3 | 6030 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain |
16 | PF00070.29 | 0.75 | 3 | 6030 | opposite-strand | Pyridine nucleotide-disulphide oxidoreductase |