Result : EXP02116

Protein Information

• Protein name: EXP02116
• NCBI Accession ID: NC_016810.1
• Organism: Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344
• Left: 3985681
• Right: 3985794
• Strand: +
• Nucleotide Sequence: ATGCATAAAAAAGGTTATTGCTTACTCACTATTTTGAGTGGGTTTTATTTTATCGACTCGGGAATATCCATCATTCCCTCCTTATACGCCTGGCGTAATGTTGCAATTGAATAA
• Sequence: MHKKGYCLLTILSGFYFIDSGISIIPSLYAWRNVAIE
• Source of smORF: Transcriptional-level
• Pubmed ID: Venturini et al 2020
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 37

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3964379	3964492	+	NC_003197.2	Salmonella enterica subsp. enterica serovar Typhimurium str. LT2
2	1782412	1782525	+	NZ_CP053416.1	Salmonella bongori

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_003197.2

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00857.22	1.0	2	3790.0	same-strand	Isochorismatase family
2	PF00122.22	1.0	2	99.0	opposite-strand	E1-E2 ATPase
3	PF00702.28	1.0	2	99.0	opposite-strand	haloacid dehalogenase-like hydrolase
4	PF00690.28	1.0	2	99.0	opposite-strand	Cation transporter/ATPase, N-terminus
5	PF00689.23	1.0	2	99.0	opposite-strand	Cation transporting ATPase, C-terminus
6	PF02308.18	1.0	2	8.5	opposite-strand	MgtC family
7	PF00892.22	1.0	2	1213.5	same-strand	EamA-like transporter family
8	PF07071.13	1.0	2	3397.0	opposite-strand	KDGP aldolase