Result : EXP02112
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02112 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 2999268 |
| Right | 2999513 |
| Strand | + |
| Nucleotide Sequence | ATGTCACTCAAAAAAACGGAAAGCACACAGCACAAACTGAAACAAACCTGTCAACTACGGCTGTGGTTAATTGTGGGTGGAGTATGTTCATTAGGAATGGGAGTACTGAATATATTGTCGTCAGGCTATTTTGAACCGTATGACGGCGGTCAAATTATCTTAGGCCTGGGATGTCTGGGATATAGTCTGGCACTATCAAAGAAGATATCCCACTTGCAGGCAGAGAATCAGCCCAAAAAGCCATAA |
| Sequence | MSLKKTESTQHKLKQTCQLRLWLIVGGVCSLGMGVLNILSSGYFEPYDGGQIILGLGCLGYSLALSKKISHLQAENQPKKP |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 81 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2976696 | 2976941 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 3318267 | 3318506 | + | NZ_LR134340.1 | Escherichia marmotae |
| 3 | 2767202 | 2767441 | + | NZ_AP014857.1 | Escherichia albertii |
| 4 | 3919800 | 3920039 | - | NZ_CP057657.1 | Escherichia fergusonii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02599.18 | 1.0 | 4 | 5468.5 | opposite-strand | Global regulator protein family |
| 2 | PF01411.21 | 1.0 | 4 | 2603.5 | opposite-strand | tRNA synthetases class II (A) |
| 3 | PF02272.21 | 1.0 | 4 | 2603.5 | opposite-strand | DHHA1 domain |
| 4 | PF07973.16 | 1.0 | 4 | 2603.5 | opposite-strand | Threonyl and Alanyl tRNA synthetase second additional domain |
| 5 | PF02631.18 | 1.0 | 4 | 1902.5 | opposite-strand | RecX family |
| 6 | PF00154.23 | 1.0 | 4 | 759.5 | opposite-strand | recA bacterial DNA recombination protein |
| 7 | PF08423.13 | 1.0 | 4 | 759.5 | opposite-strand | Rad51 |
| 8 | PF06745.15 | 1.0 | 4 | 759.5 | opposite-strand | KaiC |
| 9 | PF02464.19 | 1.0 | 4 | 182.5 | opposite-strand | Competence-damaged protein |
| 10 | PF13406.8 | 1.0 | 4 | 39.0 | opposite-strand | Transglycosylase SLT domain |
++ More..