Result : EXP02110
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02110 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 2889839 |
| Right | 2889988 |
| Strand | + |
| Nucleotide Sequence | ATGGTATGTAGGAATTTCGGACGCGGGTTCAACTCCCGCCAGCTCCACCAAATCATGATCCGGATACGTCCGGTGAAGTACAGAAAGCCCGCACAGCACAAGCCCTGCGGGCTTTTTTGTGTCTGTCGTTGTCCGAGAACATCCGGCTAA |
| Sequence | MVCRNFGRGFNSRQLHQIMIRIRPVKYRKPAQHKPCGLFCVCRCPRTSG |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3594300 | 3594449 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 2 | 8514 | 8651 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP027986.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00589.24 | 1.0 | 2 | 103.0 | same-strand | Phage integrase family |
| 2 | PF13356.8 | 1.0 | 2 | 84.0 | same-strand | Arm DNA-binding domain |
++ More..