Result : B3PM35
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Nucleoid-associated protein MARTH_orf159 |
| NCBI Accession ID | CP001047.1 |
| Organism | Mycoplasma arthritidis (strain 158L3-1) |
| Left | 153406 |
| Right | 153693 |
| Strand | + |
| Nucleotide Sequence | ATGAATATTAATGAAATGTTAAAAAAAGCAAAAAGACTTCAAGCTGAAATGGAAGTCGAAGAAAAAGAAATTGCTAAAAAGGAATTTGTTGTAAAAAAACAAGGCATCAAGGTAGTAATGCTAGGAACAAGAAAAATAAAAACAATTGAAATCTCGCCAGCTTTAATTGATCCCGAAGATCCTGAATTGGTACAAGACTTAGTGATGCTGGCTATTAATGAAGCTATTGACATTATTGACGAAGAATATGACGAACTTGGGGATAAATACTCAAATACAAGCATCTAA |
| Sequence | MNINEMLKKAKRLQAEMEVEEKEIAKKEFVVKKQGIKVVMLGTRKIKTIEISPALIDPEDPELVQDLVMLAINEAIDIIDEEYDELGDKYSNTSI |
| Source of smORF | Swiss-Prot |
| Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
| Pubmed ID | 18573899 |
| Domain | CDD:412410 |
| Functional Category | DNA-binding |
| Uniprot ID | B3PM35 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 18
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 153310 | 153597 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
| 2 | 481510 | 481803 | - | NZ_LS991949.1 | Mycoplasma alkalescens |
| 3 | 350837 | 351115 | - | NZ_CP029295.1 | Mycoplasma phocidae |
| 4 | 154431 | 154724 | - | NZ_CP030140.1 | Mycoplasma anseris |
| 5 | 240407 | 240694 | - | NZ_LR214938.2 | Mycoplasma salivarium |
| 6 | 590507 | 590794 | + | NZ_CP008748.1 | Mycoplasma hyosynoviae |
| 7 | 589937 | 590230 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 8 | 687916 | 688209 | - | NZ_CP034044.1 | Mycoplasma struthionis |
| 9 | 560226 | 560519 | - | NZ_CP030103.1 | Mycoplasma cloacale |
| 10 | 696163 | 696456 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 11 | 133835 | 134128 | + | NZ_CP055143.1 | Mycoplasma hominis |
| 12 | 497598 | 497891 | + | NZ_AP014631.1 | Mycoplasma canadense |
| 13 | 56659 | 56922 | - | NZ_CP029258.1 | Mycoplasmopsis synoviae |
| 14 | 55747 | 56040 | + | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 15 | 22990 | 23232 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 16 | 926218 | 926475 | - | NZ_LR214986.1 | Mycoplasmopsis cynos |
| 17 | 876886 | 877140 | - | NC_014014.1 | Mycoplasma crocodyli MP145 |
| 18 | 478436 | 478723 | + | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR215047.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13177.8 | 1.0 | 18 | 1228 | same-strand | DNA polymerase III, delta subunit |
| 2 | PF00004.31 | 1.0 | 18 | 1067.0 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 3 | PF02132.17 | 0.78 | 14 | 0.0 | same-strand | RecR protein |
| 4 | PF13662.8 | 0.83 | 15 | 0 | same-strand | Toprim domain |
| 5 | PF00590.22 | 0.78 | 14 | 2131.5 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
++ More..