Result : EXP02108
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02108 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 2770784 |
| Right | 2770954 |
| Strand | + |
| Nucleotide Sequence | ATGCATAACCAAAAGACATGCGCTTACCACCTGTGTGGAAAGACGATTGAGCAAGGCAAAGAAGTAAAAAACGAGCTGACGCTGATTCGCGGCGCGCAGCTGACACATGAAGAGCGCGATTACTGCTCTGTACGTTGTGCCTCATACGACCAGATGGCGCACGAAAGTTAA |
| Sequence | MHNQKTCAYHLCGKTIEQGKEVKNELTLIRGAQLTHEERDYCSVRCASYDQMAHES |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2679974 | 2680138 | + | NZ_CP013990.1 | Leclercia adecarboxylata |
| 2 | 5008838 | 5008996 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 3 | 2770343 | 2770501 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 4 | 1104592 | 1104750 | - | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 5 | 4291026 | 4291184 | + | NZ_CP053416.1 | Salmonella bongori |
| 6 | 1567946 | 1568110 | + | NZ_CP045769.1 | Enterobacter cancerogenus |
| 7 | 2518726 | 2518890 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 8 | 1830061 | 1830219 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 9 | 3578494 | 3578652 | + | NZ_CP045205.1 | Citrobacter telavivensis |
| 10 | 2607609 | 2607773 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 11 | 4764001 | 4764165 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 12 | 1790232 | 1790390 | + | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 13 | 2456896 | 2457054 | - | NZ_CP050508.1 | Raoultella terrigena |
| 14 | 2755343 | 2755501 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 15 | 2881444 | 2881599 | + | NZ_CP065838.1 | Klebsiella quasipneumoniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP013990.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF15943.7 | 0.62 | 8 | 2238.5 | opposite-strand | Putative antitoxin of bacterial toxin-antitoxin system, YdaS/YdaT |
| 2 | PF01381.24 | 0.77 | 10 | 1536 | same-strand | Helix-turn-helix |
| 3 | PF06630.13 | 0.69 | 9 | 499 | same-strand | Enterobacterial exodeoxyribonuclease VIII |
| 4 | PF03837.16 | 1.0 | 13 | 3288 | same-strand | RecT family |
| 5 | PF13269.8 | 0.92 | 12 | 4521.5 | same-strand | Protein of unknown function (DUF4060) |
++ More..