Result : EXP02094
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02094 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 1345111 |
| Right | 1345326 |
| Strand | + |
| Nucleotide Sequence | ATGATTTGGGACACAGTTTCATGCTATTACGGATTATTCCTGGAGAATTGCTTTATTAATAAGCGTTGCTGCGTTATAGTTCTGCATAATTTCTGCTATATCATGCTGTTGTATATTTCTCTTTCAACTCTGCGCAATTTATTCTTTTTTTCTTCACAATTGGCGAAAAAGTGTTTTTTATACTTTCATTGTTTTACCGTTGTTATGACTAATTGA |
| Sequence | MIWDTVSCYYGLFLENCFINKRCCVIVLHNFCYIMLLYISLSTLRNLFFFSSQLAKKCFLYFHCFTVVMTN |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 71 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1388249 | 1388464 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 4364348 | 4364542 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_003197.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00202.23 | 1.0 | 2 | 4855.5 | same-strand | Aminotransferase class-III |
| 2 | PF04958.14 | 1.0 | 2 | 3827.5 | same-strand | Arginine N-succinyltransferase beta subunit |
| 3 | PF00171.24 | 1.0 | 2 | 2348.0 | same-strand | Aldehyde dehydrogenase family |
| 4 | PF04996.14 | 1.0 | 2 | 1022.0 | same-strand | Succinylarginine dihydrolase |
| 5 | PF04952.16 | 1.0 | 2 | 53.5 | same-strand | Succinylglutamate desuccinylase / Aspartoacylase family |
| 6 | PF07813.14 | 1.0 | 2 | 79.5 | same-strand | LTXXQ motif family protein |
| 7 | PF13801.8 | 1.0 | 2 | 79.5 | same-strand | Heavy-metal resistance |
| 8 | PF02540.19 | 1.0 | 2 | 2006.5 | opposite-strand | NAD synthase |
| 9 | PF04355.15 | 1.0 | 2 | 3059.0 | same-strand | SmpA / OmlA family |
++ More..