Result : B3PKG9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | YcgL domain-containing protein CJA_2437 |
| NCBI Accession ID | CP000934.1 |
| Organism | Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa) |
| Left | 2783759 |
| Right | 2784055 |
| Strand | - |
| Nucleotide Sequence | ATGAAAATCATTGCTGAAATTTACCGCAGCCCCAAAGAGGAAGGCATGTACCTCTACGTTAAAAAAGAAGAGGGGTTGGGGCGTGTTCCCGAGGAACTGTTAACGCTCTTTGGAAAGCCACAACAGGCGATGGTATTGCTGTTGACACCGGAAAAAAAACTGGCCAATGCCGATATTGGCAAGGTTATCGAAAGCCTCAATGACAAGGGCTACTACCTGCAATTGCCGCCGCGTGACCTTGTCGATGCAGAGGCAAAGCGTATTCGTACCCTTAACAGTAAATTGTCCGGGCACTAA |
| Sequence | MKIIAEIYRSPKEEGMYLYVKKEEGLGRVPEELLTLFGKPQQAMVLLLTPEKKLANADIGKVIESLNDKGYYLQLPPRDLVDAEAKRIRTLNSKLSGH |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl22628. Profile Description: YcgL domain. This family of proteins formerly called DUF709 includes the E. coli gene ycgL. homologs of YcgL are found in gammaproteobacteria. The structure of this protein shows a novel alpha/beta/alpha sandwich structure. |
| Pubmed ID | 18556790 |
| Domain | CDD:419850 |
| Functional Category | Others |
| Uniprot ID | B3PKG9 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 19
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2783759 | 2784055 | - | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 2 | 136589 | 136876 | - | NZ_CP014143.1 | Microbulbifer aggregans |
| 3 | 3260932 | 3261222 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 4 | 2908316 | 2908603 | - | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 5 | 1000454 | 1000699 | + | NZ_CP019650.1 | Microbulbifer agarilyticus |
| 6 | 4035666 | 4035953 | - | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 7 | 415934 | 416227 | + | NZ_CP009365.1 | Pseudomonas soli |
| 8 | 4331003 | 4331296 | - | NC_008027.1 | Pseudomonas entomophila L48 |
| 9 | 4913668 | 4913961 | + | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 10 | 2796319 | 2796612 | + | NZ_CP060092.1 | Teredinibacter purpureus |
| 11 | 68860 | 69153 | + | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 12 | 1576150 | 1576443 | + | NZ_CP071706.1 | Pseudomonas donghuensis |
| 13 | 4647732 | 4648004 | - | NZ_CP011104.1 | Photorhabdus thracensis |
| 14 | 1609444 | 1609737 | + | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 15 | 4434655 | 4434948 | - | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 16 | 1783110 | 1783403 | + | NZ_CP068034.2 | Pseudomonas syringae |
| 17 | 4530496 | 4530789 | - | NZ_CP070503.1 | Pseudomonas atacamensis |
| 18 | 2189954 | 2190223 | - | NZ_CP016043.1 | Edwardsiella hoshinae |
| 19 | 1620470 | 1620763 | + | NZ_CP034725.1 | Pseudomonas brassicacearum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010995.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03692.17 | 1.0 | 19 | 1095 | same-strand | Putative zinc- or iron-chelating domain |
| 2 | PF01612.22 | 1.0 | 19 | -3 | same-strand | 3'-5' exonuclease |
| 3 | PF00570.25 | 1.0 | 19 | -3 | same-strand | HRDC domain |
++ More..