Result : EXP02080
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02080 |
| NCBI Accession ID | NC_016810.1 |
| Organism | Salmonella enterica subsp. enterica serovar Typhimurium str. SL1344 |
| Left | 539479 |
| Right | 539577 |
| Strand | + |
| Nucleotide Sequence | ATGATGTGGGTGCGGGTGCTGCTGTTGGTTATTTTGGCCTGTCTGCTGATTTTTATGTGGCGGATACCGGTGATTGATGAAAAGCAACAAAAGCGCTGA |
| Sequence | MMWVRVLLLVILACLLIFMWRIPVIDEKQQKR |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | Venturini et al 2020 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 85
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 539994 | 540092 | + | NC_003197.2 | Salmonella enterica subsp. enterica serovar Typhimurium str. LT2 |
| 2 | 4351125 | 4351205 | - | NZ_CP050508.1 | Raoultella terrigena |
| 3 | 1251906 | 1251986 | + | NC_016845.1 | Klebsiella pneumoniae subsp. pneumoniae HS11286 |
| 4 | 3959095 | 3959175 | - | NZ_CP065838.1 | Klebsiella quasipneumoniae |
| 5 | 4226821 | 4226901 | - | NZ_CP054254.1 | Klebsiella variicola |
| 6 | 557057 | 557155 | + | NC_002695.2 | Escherichia coli O157:H7 str. Sakai |
| 7 | 491161 | 491259 | + | NC_000913.3 | Escherichia coli str. K-12 substr. MG1655 |
| 8 | 427692 | 427790 | + | NC_004337.2 | Shigella flexneri 2a str. 301 |
| 9 | 3171333 | 3171431 | + | NZ_CP061527.1 | Shigella dysenteriae |
| 10 | 3001284 | 3001364 | + | NZ_CP026047.1 | Raoultella planticola |
| 11 | 4240804 | 4240884 | - | NZ_CP046672.1 | Raoultella ornithinolytica |
| 12 | 4007229 | 4007309 | - | NZ_CP041247.1 | Raoultella electrica |
| 13 | 509161 | 509259 | + | NZ_AP014857.1 | Escherichia albertii |
| 14 | 1170661 | 1170741 | + | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 15 | 2910417 | 2910503 | - | NZ_CP014137.1 | Brenneria goodwinii |
| 16 | 3996334 | 3996432 | + | NZ_CP033744.1 | Citrobacter freundii |
| 17 | 1119385 | 1119483 | - | NZ_CP044098.1 | Citrobacter portucalensis |
| 18 | 224766 | 224864 | + | NZ_CP017279.1 | Enterobacter ludwigii |
| 19 | 17692 | 17790 | + | NZ_CP023529.1 | Lelliottia amnigena |
| 20 | 3071456 | 3071545 | + | NZ_CP053416.1 | Salmonella bongori |
| 21 | 2486112 | 2486210 | - | NC_009792.1 | Citrobacter koseri ATCC BAA-895 |
| 22 | 1116872 | 1116970 | + | NZ_AP022508.1 | Enterobacter bugandensis |
| 23 | 1063895 | 1063993 | + | NC_015968.1 | Enterobacter soli |
| 24 | 1142411 | 1142509 | + | NZ_CP009756.1 | Enterobacter cloacae |
| 25 | 1441115 | 1441213 | - | NZ_CP025034.2 | Enterobacter sp. SGAir0187 |
| 26 | 3627814 | 3627912 | + | NZ_AP019007.1 | Enterobacter oligotrophicus |
| 27 | 1307862 | 1307960 | + | NZ_CP043318.1 | Enterobacter chengduensis |
| 28 | 1136043 | 1136132 | + | NZ_LR134340.1 | Escherichia marmotae |
| 29 | 2460781 | 2460879 | - | NZ_CP045769.1 | Enterobacter cancerogenus |
| 30 | 586436 | 586534 | + | NC_013716.1 | Citrobacter rodentium ICC168 |
| 31 | 1109667 | 1109765 | + | NZ_CP027986.1 | Enterobacter sichuanensis |
| 32 | 1171174 | 1171272 | + | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 33 | 1890998 | 1891096 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 34 | 1067600 | 1067689 | + | NZ_CP017184.1 | Enterobacter roggenkampii |
| 35 | 1163531 | 1163638 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 36 | 4409230 | 4409328 | - | NZ_CP045205.1 | Citrobacter telavivensis |
| 37 | 2703107 | 2703205 | + | NZ_LT556085.1 | Citrobacter amalonaticus |
| 38 | 572567 | 572665 | - | NZ_CP042941.1 | Atlantibacter hermannii |
| 39 | 4055204 | 4055302 | - | NZ_CP014007.2 | Kosakonia oryzae |
| 40 | 1059908 | 1060006 | + | NZ_CP015113.1 | Kosakonia radicincitans |
| 41 | 1230932 | 1231027 | + | NZ_CP025799.1 | Dickeya zeae |
| 42 | 1596980 | 1597069 | - | NZ_CP057657.1 | Escherichia fergusonii |
| 43 | 480701 | 480796 | + | NZ_CP028271.1 | Mixta intestinalis |
| 44 | 3489130 | 3489225 | - | NZ_CP054058.1 | Scandinavium goeteborgense |
| 45 | 1120911 | 1120991 | + | NZ_CP023525.1 | Cedecea neteri |
| 46 | 2156218 | 2156316 | - | NZ_CP038469.1 | Citrobacter tructae |
| 47 | 2875670 | 2875759 | - | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 48 | 3435682 | 3435780 | - | NZ_CP045845.1 | Kluyvera intermedia |
| 49 | 3948332 | 3948421 | - | NZ_LR134475.1 | Klebsiella aerogenes |
| 50 | 1188479 | 1188574 | + | NZ_CP012871.1 | [Enterobacter] lignolyticus |
| 51 | 1160204 | 1160293 | + | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 52 | 4591930 | 4592013 | - | NZ_CP051548.1 | Phytobacter diazotrophicus |
| 53 | 2355803 | 2355883 | - | NZ_CP067057.1 | Rahnella aceris |
| 54 | 2973287 | 2973376 | - | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 55 | 4566308 | 4566397 | - | NZ_CP036175.1 | Klebsiella huaxiensis |
| 56 | 2266116 | 2266205 | - | NZ_CP027107.1 | Cronobacter sakazakii |
| 57 | 4644974 | 4645054 | - | NZ_CP060111.1 | Klebsiella michiganensis |
| 58 | 1165014 | 1165103 | + | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 59 | 3680987 | 3681076 | - | NZ_CP013990.1 | Leclercia adecarboxylata |
| 60 | 3458229 | 3458327 | - | NZ_CP035129.1 | Kosakonia cowanii |
| 61 | 3362336 | 3362425 | - | NZ_CP011602.1 | Phytobacter ursingii |
| 62 | 2940933 | 2941037 | - | NC_017910.1 | Shimwellia blattae DSM 4481 = NBRC 105725 |
| 63 | 1380383 | 1380475 | - | NZ_CP014136.1 | Gibbsiella quercinecans |
| 64 | 2253913 | 2254011 | + | NZ_CP020388.1 | Pluralibacter gergoviae |
| 65 | 2651144 | 2651227 | + | NZ_CP065640.1 | Serratia rubidaea |
| 66 | 1147426 | 1147518 | + | NZ_CP046293.1 | Yersinia intermedia |
| 67 | 1283304 | 1283405 | + | NZ_CP050150.1 | Hafnia alvei |
| 68 | 1074015 | 1074095 | + | NZ_LR134201.1 | Cedecea lapagei |
| 69 | 1237815 | 1237898 | + | NZ_CP061511.1 | Mixta calida |
| 70 | 1496592 | 1496684 | - | NZ_CP009781.1 | Yersinia aldovae 670-83 |
| 71 | 3781898 | 3782002 | - | NZ_CP026364.1 | Proteus hauseri |
| 72 | 1655816 | 1655911 | - | NC_010554.1 | Proteus mirabilis HI4320 |
| 73 | 1174163 | 1174255 | + | NZ_LR134494.1 | Serratia quinivorans |
| 74 | 2221379 | 2221483 | - | NZ_CP047349.1 | Proteus terrae subsp. cibarius |
| 75 | 2854291 | 2854371 | - | NZ_CP032487.1 | Yersinia hibernica |
| 76 | 1031710 | 1031805 | + | NZ_CP034035.1 | Brenneria rubrifaciens |
| 77 | 3362425 | 3362508 | - | NZ_LR134373.1 | Yersinia pseudotuberculosis |
| 78 | 2556324 | 2556410 | - | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 79 | 2833098 | 2833181 | + | NZ_CP007230.1 | Yersinia similis |
| 80 | 3430823 | 3430903 | - | NZ_CP011118.1 | Yersinia enterocolitica |
| 81 | 3414116 | 3414196 | - | NZ_CP043727.1 | Yersinia canariae |
| 82 | 3215360 | 3215458 | + | NZ_CP015750.1 | Pectobacterium wasabiae CFBP 3304 |
| 83 | 332002 | 332100 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
| 84 | 3534046 | 3534144 | - | NZ_CP051652.1 | Pectobacterium carotovorum |
| 85 | 4854866 | 4854946 | - | NZ_CP007044.2 | Chania multitudinisentens RB-25 |
| 86 | 144456 | 144554 | + | NZ_CP017482.1 | Pectobacterium polaris |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP050508.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08361.13 | 0.86 | 73 | 4583.5 | same-strand | MAATS-type transcriptional repressor, C-terminal region |
| 2 | PF00440.25 | 0.86 | 73 | 4583.5 | same-strand | Bacterial regulatory proteins, tetR family |
| 3 | PF12794.9 | 0.81 | 69 | 1131.0 | same-strand | Mechanosensitive ion channel inner membrane domain 1 |
| 4 | PF00924.20 | 0.81 | 69 | 1131.0 | same-strand | Mechanosensitive ion channel |
| 5 | PF12795.9 | 0.81 | 69 | 1131.0 | same-strand | Mechanosensitive ion channel porin domain |
| 6 | PF10689.11 | 0.92 | 78 | 891 | opposite-strand | Protein of unknown function (DUF2496) |
| 7 | PF07445.14 | 0.94 | 80 | 355 | opposite-strand | Primosomal replication protein priC |
| 8 | PF12170.10 | 0.95 | 81 | 821.5 | same-strand | DNA polymerase III tau subunit V interacting with alpha |
| 9 | PF13177.8 | 0.95 | 81 | 818.5 | same-strand | DNA polymerase III, delta subunit |
| 10 | PF12169.10 | 0.95 | 81 | 818.5 | same-strand | DNA polymerase III subunits gamma and tau domain III |
| 11 | PF12168.10 | 0.94 | 80 | 819 | same-strand | DNA polymerase III subunits tau domain IV DnaB-binding |
| 12 | PF00004.31 | 0.95 | 81 | 819 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 13 | PF13401.8 | 0.82 | 70 | 804 | same-strand | AAA domain |
| 14 | PF02575.18 | 0.95 | 81 | 2826.5 | same-strand | YbaB/EbfC DNA-binding family |
| 15 | PF13662.8 | 0.87 | 74 | 3146 | same-strand | Toprim domain |
| 16 | PF02132.17 | 0.87 | 74 | 3146 | same-strand | RecR protein |
| 17 | PF01751.24 | 0.87 | 74 | 3146 | same-strand | Toprim domain |
| 18 | PF00183.20 | 0.79 | 67 | 3865.5 | same-strand | Hsp90 protein |
| 19 | PF02518.28 | 0.85 | 72 | 3871 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 20 | PF13589.8 | 0.78 | 66 | 3870 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 21 | PF16576.7 | 0.73 | 62 | 5372 | opposite-strand | Barrel-sandwich domain of CusB or HlyD membrane-fusion |
| 22 | PF00529.22 | 0.73 | 62 | 5372 | opposite-strand | Cation efflux system protein CusB domain 1 |
| 23 | PF13437.8 | 0.65 | 55 | 5372.0 | opposite-strand | HlyD family secretion protein |
++ More..