Result : B3PIL7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Ribosome modulation factor (RMF) |
| NCBI Accession ID | CP000934.1 |
| Organism | Cellvibrio japonicus (strain Ueda107) (Pseudomonas fluorescens subsp. cellulosa) |
| Left | 2488054 |
| Right | 2488278 |
| Strand | + |
| Nucleotide Sequence | ATGAAACGCCAAAAACGTGACCAAACAGAACGCGCATTCGTTAAAGGGTATCAAGCAGGTATTGAGGGGCGTTCAAAAAGCCTATGTCCACATGAGTCCGGCCTGGCCCGTCAGCAGTGGCTGAATGGCTGGCGCGAATCGCGCATGGACCAGTGGGATGGCTACAGTCGTTTGGCACAGGTTCAAAAAATCACCAATTTACATCCCATGTCTATGAGCGGCTAA |
| Sequence | MKRQKRDQTERAFVKGYQAGIEGRSKSLCPHESGLARQQWLNGWRESRMDQWDGYSRLAQVQKITNLHPMSMSG |
| Source of smORF | Swiss-Prot |
| Function | During stationary phase, converts 70S ribosomes to an inactive dimeric form (100S ribosomes). {ECO:0000255|HAMAP-Rule:MF_00919}. |
| Pubmed ID | 18556790 |
| Domain | CDD:420038 |
| Functional Category | Others |
| Uniprot ID | B3PIL7 |
| ORF Length (Amino Acid) | 74 |
++ More..
| Conservation Analysis |
No. of Species: 41
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2488054 | 2488278 | + | NC_010995.1 | Cellvibrio japonicus Ueda107 |
| 2 | 2234058 | 2234264 | - | NC_007912.1 | Saccharophagus degradans 2-40 |
| 3 | 4196324 | 4196527 | + | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 4 | 795520 | 795723 | + | NZ_CP022684.1 | Ketobacter alkanivorans |
| 5 | 3204850 | 3205053 | - | NZ_CP060092.1 | Teredinibacter purpureus |
| 6 | 1526855 | 1527058 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 7 | 1802495 | 1802710 | + | NZ_CP011797.1 | Reinekea forsetii |
| 8 | 228245 | 228448 | - | NC_018868.3 | Simiduia agarivorans SA1 = DSM 21679 |
| 9 | 4379937 | 4380140 | + | NZ_CP019343.1 | Oceanicoccus sagamiensis |
| 10 | 2724863 | 2725066 | + | NZ_CP036422.1 | Halioglobus maricola |
| 11 | 2039419 | 2039634 | - | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 12 | 470438 | 470653 | + | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 13 | 2029406 | 2029621 | - | NZ_CP060009.1 | Pseudomonas sediminis |
| 14 | 3624636 | 3624851 | + | NZ_CP068551.1 | Pseudomonas khazarica |
| 15 | 2266097 | 2266303 | + | NZ_CP004387.1 | Alcanivorax pacificus W11-5 |
| 16 | 2493181 | 2493390 | - | NZ_CP048878.1 | Spartinivicinus ruber |
| 17 | 5102051 | 5102260 | + | NC_007645.1 | Hahella chejuensis KCTC 2396 |
| 18 | 1452753 | 1452965 | - | NC_017506.1 | Marinobacter adhaerens HP15 |
| 19 | 1802083 | 1802298 | - | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 20 | 1930675 | 1930890 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 21 | 1921673 | 1921876 | - | NZ_CP047491.1 | Microbulbifer hydrolyticus |
| 22 | 4529959 | 4530177 | + | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 23 | 1790346 | 1790555 | - | NZ_CP043042.1 | Marinobacter fonticola |
| 24 | 1633211 | 1633423 | - | NZ_CP011494.1 | Marinobacter psychrophilus |
| 25 | 2244987 | 2245190 | + | NZ_CP014544.1 | Zhongshania aliphaticivorans |
| 26 | 3300801 | 3301013 | - | NZ_CP007142.1 | Gynuella sunshinyii YC6258 |
| 27 | 3414401 | 3414613 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 28 | 2557345 | 2557560 | - | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 29 | 3669898 | 3670113 | + | NZ_CP068034.2 | Pseudomonas syringae |
| 30 | 2964916 | 2965131 | + | NZ_CP011835.1 | Azotobacter chroococcum |
| 31 | 419032 | 419247 | - | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 32 | 3963072 | 3963290 | + | NZ_CP047698.1 | Pseudomonas knackmussii |
| 33 | 1760503 | 1760718 | - | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 34 | 1880779 | 1880994 | - | NC_012560.1 | Azotobacter vinelandii DJ |
| 35 | 2022050 | 2022268 | - | NZ_CP014158.1 | Pseudomonas citronellolis |
| 36 | 2696241 | 2696450 | + | NZ_CP020931.1 | Marinobacter salarius |
| 37 | 1613257 | 1613469 | + | NZ_CP017715.1 | Marinobacter salinus |
| 38 | 4381071 | 4381286 | - | NZ_CP045302.1 | Azotobacter salinestris |
| 39 | 2127962 | 2128156 | + | NZ_CP051183.1 | Bermanella marisrubri |
| 40 | 4349623 | 4349826 | - | NZ_CP048711.1 | Kineobactrum salinum |
| 41 | 1376864 | 1377061 | + | NZ_CP045871.1 | Litoricola lipolytica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010995.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01170.20 | 0.93 | 38 | 411.5 | opposite-strand | Putative RNA methylase family UPF0020 |
| 2 | PF01180.23 | 0.9 | 37 | 96 | opposite-strand | Dihydroorotate dehydrogenase |
++ More..