Result : EXP02069
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02069 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 4311704 |
| Right | 4311853 |
| Strand | - |
| Nucleotide Sequence | GTGCGATACCTGGGGTCCTGGCCGACGGGGCCAGCGGCAGGGGCGCAGCCGCCCCTGGTAGACGAAGCATCACGCTGGTTAGCGCGGCTCCGCGCGGGCAAACCCGAGCAGACCCTGGTTCGCCCGGACGACCAGGGGGCGCAAGCATGA |
| Sequence | VRYLGSWPTGPAAGAQPPLVDEASRWLARLRAGKPEQTLVRPDDQGAQA |
| Source of smORF | Transcriptional-level |
| Function | It is a short ORF coupled to a downstream gene whose start codon overlaps the stop codon of this ORF. This indicates that this smORF might be translationally coupled to downstream gene. Pubmed:26536359 |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4311704 | 4311853 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 4378953 | 4379102 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 3767849 | 3768007 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02403.24 | 1.0 | 3 | 2791 | same-strand | Seryl-tRNA synthetase N-terminal domain |
| 2 | PF00587.27 | 1.0 | 3 | 2791 | same-strand | tRNA synthetase class II core domain (G, H, P, S and T) |
| 3 | PF13845.8 | 1.0 | 3 | 1309 | opposite-strand | Septum formation |
| 4 | PF06262.13 | 1.0 | 3 | 954 | opposite-strand | Zincin-like metallopeptidase |
| 5 | PF00300.24 | 1.0 | 3 | -3 | same-strand | Histidine phosphatase superfamily (branch 1) |
| 6 | PF10615.11 | 1.0 | 3 | 912 | opposite-strand | Protein of unknown function (DUF2470) |
| 7 | PF00210.26 | 1.0 | 3 | 2362 | opposite-strand | Ferritin-like domain |
| 8 | PF03009.19 | 1.0 | 3 | 2922 | same-strand | Glycerophosphoryl diester phosphodiesterase family |
| 9 | PF14219.8 | 1.0 | 3 | 3752 | same-strand | Domain of unknown function (DUF4328) |
++ More..