Result : EXP02065
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02065 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 948888 |
| Right | 949001 |
| Strand | - |
| Nucleotide Sequence | ATGGCGTCGAACCAGTCGAAGAAGACCCGTGAGCGGAGCAATTCCACGATCGGCTCACGACTGCGTACTCCGATCATTACCAGCACACGGCCAGAGTCGTGCGTTGACGCGTAG |
| Sequence | MASNQSKKTRERSNSTIGSRLRTPIITSTRPESCVDA |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 37 |
++ More..
| Conservation Analysis |
No. of Species: 35
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 956686 | 956799 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 948888 | 949001 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 3236489 | 3236599 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 4 | 4920513 | 4920641 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 5 | 3395161 | 3395271 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 6 | 4466610 | 4466738 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 7 | 2756354 | 2756482 | + | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 8 | 5442368 | 5442496 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 9 | 4579743 | 4579853 | - | NZ_AP022576.1 | Mycobacterium florentinum |
| 10 | 3446846 | 3446944 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 11 | 818440 | 818550 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 12 | 4849053 | 4849163 | - | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 13 | 539551 | 539661 | + | NZ_CP058277.1 | Mycobacterium marinum |
| 14 | 5271641 | 5271751 | + | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 15 | 831811 | 831921 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 16 | 5560273 | 5560383 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 17 | 4501882 | 4501992 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 18 | 842631 | 842741 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 19 | 828817 | 828927 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 20 | 1489656 | 1489784 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 21 | 2955389 | 2955499 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 22 | 2179533 | 2179643 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 23 | 2338510 | 2338620 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 24 | 5793459 | 5793569 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
| 25 | 3681528 | 3681650 | + | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 26 | 4725238 | 4725366 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 27 | 516484 | 516612 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 28 | 4451405 | 4451533 | - | NZ_AP022588.1 | Mycolicibacterium sediminis |
| 29 | 3858020 | 3858118 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 30 | 174765 | 174875 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 31 | 771915 | 772010 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 32 | 702646 | 702756 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 33 | 2320390 | 2320518 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 34 | 3689148 | 3689258 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 35 | 4715472 | 4715600 | + | NZ_CP012150.1 | Mycobacterium goodii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022619.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02776.20 | 0.66 | 23 | 568 | same-strand | Thiamine pyrophosphate enzyme, N-terminal TPP binding domain |
| 2 | PF02775.23 | 0.66 | 23 | 568 | same-strand | Thiamine pyrophosphate enzyme, C-terminal TPP binding domain |
| 3 | PF10604.11 | 0.66 | 23 | 2349.5 | opposite-strand | Polyketide cyclase / dehydrase and lipid transport |
| 4 | PF03364.22 | 0.66 | 23 | 2372 | opposite-strand | Polyketide cyclase / dehydrase and lipid transport |
| 5 | PF02515.19 | 0.6 | 21 | 2777 | opposite-strand | CoA-transferase family III |
| 6 | PF04324.17 | 0.63 | 22 | 381.0 | opposite-strand | BFD-like [2Fe-2S] binding domain |
| 7 | PF00501.30 | 0.74 | 26 | 471 | opposite-strand | AMP-binding enzyme |
| 8 | PF13193.8 | 0.74 | 26 | 471 | opposite-strand | AMP-binding enzyme C-terminal domain |
| 9 | PF04909.16 | 0.63 | 22 | 1751.0 | opposite-strand | Amidohydrolase |
++ More..