Result : EXP02060
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02060 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 685203 |
| Right | 685352 |
| Strand | - |
| Nucleotide Sequence | GTGAAGATGATCAACACGGTCAACGGAATCGACACCGCCAGGGTTGGCAGCAACGAGACGCTGGTAATGAACCAGCCCTGCTCGATCGCCTCACGCCAATGGAAGGGCCGCCGAACCAGCGCCTTGCCAGTCAGTACGCATGTCCGGTAG |
| Sequence | VKMINTVNGIDTARVGSNETLVMNQPCSIASRQWKGRRTSALPVSTHVR |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 700284 | 700433 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 685203 | 685352 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 4269296 | 4269445 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 4 | 5145863 | 5145988 | - | NZ_AP022614.1 | Mycobacterium parmense |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00392.23 | 0.75 | 3 | 71 | opposite-strand | Bacterial regulatory proteins, gntR family |
| 2 | PF07729.14 | 0.75 | 3 | 71 | opposite-strand | FCD domain |
| 3 | PF02405.18 | 1.0 | 4 | 225.5 | opposite-strand | Permease MlaE |
| 4 | PF11887.10 | 1.0 | 4 | 1470.0 | opposite-strand | Cholesterol uptake porter CUP1 of Mce4, putative |
| 5 | PF02470.22 | 1.0 | 4 | 2685 | opposite-strand | MlaD protein |
++ More..