Result : EXP02056
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02056 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 4299879 |
| Right | 4300022 |
| Strand | - |
| Nucleotide Sequence | GTGGGGCCAATATCACTGCACGGTCACCAATTGCGGCATGGCGGCGGACTTCTGCTGCAACGTTTAGGGTTCGCCGATACACCTGCGACCACGTCAGGCTTTCACTTATGCCCTCCGAATCCCGTTCGTAATCGATGTAAGTGA |
| Sequence | VGPISLHGHQLRHGGGLLLQRLGFADTPATTSGFHLCPPNPVRNRCK |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4366964 | 4367107 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 4299879 | 4300022 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08237.13 | 1.0 | 2 | 11932.5 | opposite-strand | PE-PPE domain |
| 2 | PF03176.17 | 1.0 | 2 | 8416.5 | same-strand | MMPL family |
| 3 | PF12349.10 | 1.0 | 2 | 8416.5 | same-strand | Sterol-sensing domain of SREBP cleavage-activation |
| 4 | PF00698.23 | 1.0 | 2 | 367.0 | same-strand | Acyl transferase domain |
| 5 | PF00109.28 | 1.0 | 2 | 367.0 | same-strand | Beta-ketoacyl synthase, N-terminal domain |
| 6 | PF08659.12 | 1.0 | 2 | 367.0 | same-strand | KR domain |
| 7 | PF14765.8 | 1.0 | 2 | 367.0 | same-strand | Polyketide synthase dehydratase |
| 8 | PF02801.24 | 1.0 | 2 | 367.0 | same-strand | Beta-ketoacyl synthase, C-terminal domain |
| 9 | PF00107.28 | 1.0 | 2 | 367.0 | same-strand | Zinc-binding dehydrogenase |
| 10 | PF13602.8 | 1.0 | 2 | 367.0 | same-strand | Zinc-binding dehydrogenase |
| 11 | PF16197.7 | 1.0 | 2 | 367.0 | same-strand | Ketoacyl-synthetase C-terminal extension |
| 12 | PF00106.27 | 1.0 | 2 | 367.0 | same-strand | short chain dehydrogenase |
| 13 | PF00550.27 | 1.0 | 2 | 367.0 | same-strand | Phosphopantetheine attachment site |
| 14 | PF00501.30 | 1.0 | 2 | -143.0 | opposite-strand | AMP-binding enzyme |
| 15 | PF01385.21 | 1.0 | 2 | 1544.5 | same-strand | Probable transposase |
| 16 | PF00239.23 | 1.0 | 2 | 2845.5 | same-strand | Resolvase, N terminal domain |
| 17 | PF00440.25 | 1.0 | 2 | 5115.5 | same-strand | Bacterial regulatory proteins, tetR family |
| 18 | PF11196.10 | 1.0 | 2 | 5816.5 | opposite-strand | Terpene cyclase DEP1 |
++ More..