Result : EXP02050
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02050 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 4174051 |
| Right | 4174200 |
| Strand | - |
| Nucleotide Sequence | ATGGCCGATCAAAAACAGGTCCGGGCGTTTCCACATCACTCCAGGTTATTGACAGAACGTAGCGGGTTCCTTCCGGCAGGCGGACGTTTTTCCAGAAACCTTCTCCCTGCAGAACGCAGACCAGCGACCACTGGCTTTGCAGATGCGTAG |
| Sequence | MADQKQVRAFPHHSRLLTERSGFLPAGGRFSRNLLPAERRPATTGFADA |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4243502 | 4243651 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 4174051 | 4174200 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00107.28 | 1.0 | 2 | 1437.0 | opposite-strand | Zinc-binding dehydrogenase |
| 2 | PF13450.8 | 1.0 | 2 | -149.0 | opposite-strand | NAD(P)-binding Rossmann-like domain |
| 3 | PF01734.24 | 1.0 | 2 | 731.5 | opposite-strand | Patatin-like phospholipase |
| 4 | PF00027.31 | 1.0 | 2 | 731.5 | opposite-strand | Cyclic nucleotide-binding domain |
| 5 | PF08241.14 | 1.0 | 2 | 4034.0 | opposite-strand | Methyltransferase domain |
| 6 | PF13649.8 | 1.0 | 2 | 4034.0 | opposite-strand | Methyltransferase domain |
| 7 | PF04055.23 | 1.0 | 2 | 4034.0 | opposite-strand | Radical SAM superfamily |
| 8 | PF13489.8 | 1.0 | 2 | 4034.0 | opposite-strand | Methyltransferase domain |
| 9 | PF08242.14 | 1.0 | 2 | 4034.0 | opposite-strand | Methyltransferase domain |
| 10 | PF01896.21 | 1.0 | 2 | 6465.0 | same-strand | DNA primase small subunit |
| 11 | PF01068.23 | 1.0 | 2 | 7543.0 | opposite-strand | ATP dependent DNA ligase domain |
| 12 | PF04679.17 | 1.0 | 2 | 7543.0 | opposite-strand | ATP dependent DNA ligase C terminal region |
++ More..