Protein Information |
Information Type | Description |
---|---|
Protein name | EXP02048 |
NCBI Accession ID | NC_000962.3 |
Organism | Mycobacterium tuberculosis H37Rv |
Left | 4126020 |
Right | 4126112 |
Strand | - |
Nucleotide Sequence | ATGACGATGTCGTACCGGCCTTCGGAGTACGCGGGGAAGAACGCGGAATTCTCCGGATCGACGACGCACAGCCGGGTCGCGTGCCGTCGGTAG |
Sequence | MTMSYRPSEYAGKNAEFSGSTTHSRVACRR |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | 26536359 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 30 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 4195576 | 4195668 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
2 | 4126020 | 4126112 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
3 | 4926808 | 4926900 | - | NZ_AP018164.1 | Mycobacterium shigaense |
4 | 3608707 | 3608799 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
5 | 4998619 | 4998711 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
6 | 2783860 | 2783940 | + | NZ_CP006842.1 | Corynebacterium glyciniphilum AJ 3170 |
7 | 6754686 | 6754778 | + | NC_013729.1 | Kribbella flavida DSM 17836 |
8 | 524279 | 524359 | - | NZ_CP022521.1 | Actinoalloteichus hoggarensis |
9 | 474284 | 474373 | + | NZ_CP032229.1 | Streptomyces seoulensis |
10 | 7741460 | 7741543 | + | NC_009142.1 | Saccharopolyspora erythraea NRRL 2338 |
11 | 3204369 | 3204458 | + | NZ_CP045737.1 | Aeromicrobium yanjiei |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00291.27 | 1.0 | 11 | -92 | opposite-strand | Pyridoxal-phosphate dependent enzyme |