ProsmORF-pred
Result : B3EUG8
Protein Information
Information Type Description
Protein name 30S ribosomal protein S21
NCBI Accession ID CP001102.1
Organism Amoebophilus asiaticus (strain 5a2)
Left 163219
Right 163413
Strand +
Nucleotide Sequence ATGATTGTAGTACAGGTTAAAGATAATGAACCCATAGAGAGAGCATTAAAACGCTTTAAGAAAAAAATAGATCGGGTGAAAGTACTTAAAGAAGTTAAGAGCAGAAGATATTATACAAAACCTTCTATTAAACGTAGAGAGGAGAAGCTAAAAGCTATTTATAAGCAACATTTACAGCAACAAGCAAACGGATAA
Sequence MIVVQVKDNEPIERALKRFKKKIDRVKVLKEVKSRRYYTKPSIKRREEKLKAIYKQHLQQQANG
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed
Pubmed ID 20023027
Domain CDD:412427
Functional Category Ribosomal_protein
Uniprot ID B3EUG8
ORF Length (Amino Acid) 64
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 87
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 4222592 4222786 + NZ_CP048222.1 Rhodocytophaga rosea
2 2680376 2680570 + NZ_CP030041.1 Echinicola strongylocentroti
3 1905471 1905665 - NZ_CP009621.1 Pontibacter korlensis
4 863004 863198 - NZ_CP012836.1 Algoriphagus sanaruensis
5 3211530 3211724 - NZ_CP047984.1 Pontibacter russatus
6 4426113 4426307 - NZ_CP021235.1 Pontibacter actiniarum
7 3473754 3473948 + NZ_CP012040.1 Cyclobacterium amurskyense
8 3412643 3412837 + NC_015914.1 Cyclobacterium marinum DSM 745
9 884966 885160 + NZ_CP040106.1 Echinicola rosea
10 944194 944388 + NC_019904.1 Echinicola vietnamensis DSM 17526
11 558186 558380 + NC_018010.1 Belliella baltica DSM 15883
12 597069 597263 - NZ_CP037922.1 Hymenobacter radiodurans
13 3566286 3566480 - NZ_CP047897.1 Nibribacter ruber
14 2448248 2448442 - NZ_CP014766.1 Pontibacter akesuensis
15 4366034 4366231 + NC_018018.1 Bernardetia litoralis DSM 6794
16 2871962 2872156 + NZ_CP048106.1 Pontibacter pudoricolor
17 2436354 2436548 - NZ_CP055156.1 Adhaeribacter swui
18 2754793 2754987 - NZ_CP040896.1 Hymenobacter jejuensis
19 1937242 1937436 + NZ_CP050954.1 Hymenobacter sp. BT18
20 6684485 6684679 - NZ_CP055153.1 Adhaeribacter radiodurans
21 1454962 1455156 + NZ_CP013909.1 Hymenobacter sedentarius
22 1057796 1057987 - NZ_CP007451.1 Draconibacterium orientale
23 198479 198673 - NZ_CP010777.1 Rufibacter radiotolerans
24 3520323 3520517 + NZ_CP040812.1 Antarcticibacterium flavum
25 1144452 1144646 + NZ_CP034549.1 Nonlabens ponticola
26 4133802 4134002 + NZ_CP007145.1 Hymenobacter swuensis DY53
27 426934 427128 - NZ_CP044285.1 Hymenobacter baengnokdamensis
28 2213750 2213941 - NZ_CP032819.1 Butyricimonas faecalis
29 2844382 2844573 + NC_014759.1 Marivirga tractuosa DSM 4126
30 1513867 1514061 + NZ_CP006828.1 Ornithobacterium rhinotracheale ORT-UMN 88
31 2361781 2361972 - NZ_LT906459.1 Odoribacter splanchnicus
32 1769533 1769727 - NZ_CP042476.1 Antarcticibacterium arcticum
33 4993688 4993885 - NZ_CP010429.1 Spirosoma radiotolerans
34 8183138 8183335 - NZ_CP025096.1 Spirosoma pollinicola
35 1063659 1063850 + NZ_CP041345.1 Tenuifilum thalassicum
36 705067 705264 + NZ_CP020822.1 Tenacibaculum maritimum
37 3070795 3070986 + NZ_CP021904.1 Alkalitalea saponilacus
38 1168562 1168753 + NZ_CP045696.1 Sodaliphilus pleomorphus
39 2910879 2911073 - NZ_CP029145.1 Hymenobacter nivis
40 8263047 8263244 - NZ_CP050063.1 Spirosoma aureum
41 6730294 6730491 - NZ_CP020104.1 Spirosoma aerolatum
42 1459736 1459927 + NZ_CP069450.1 Butyricimonas virosa
43 246002 246193 + NZ_LR027382.1 Alistipes megaguti
44 2675620 2675811 - NZ_CP038029.1 Sphingobacterium psychroaquaticum
45 3103564 3103755 - NZ_CP054012.1 Parabacteroides distasonis
46 2234956 2235147 - NZ_AP019736.1 Alistipes dispar
47 2929430 2929627 + NZ_CP020105.1 Spirosoma rigui
48 3683884 3684075 - NZ_CP032317.1 Hymenobacter oligotrophus
49 3066702 3066893 - NZ_CP049246.1 Sphingobacterium lactis
50 3904047 3904241 - NC_016940.1 Saprospira grandis str. Lewin
51 2707004 2707195 - NZ_LR590470.1 Sphingobacterium daejeonense
52 2931439 2931630 + NZ_LT608328.1 Petrimonas mucosa
53 1355895 1356092 - NZ_CP013118.1 Salinivirga cyanobacteriivorans
54 3677626 3677817 + NZ_LT605205.1 Proteiniphilum saccharofermentans
55 2180574 2180765 + NZ_AP019735.1 Alistipes communis
56 1545352 1545543 - NZ_AP023049.1 Alistipes indistinctus
57 458875 459069 - NZ_LR590484.1 Sphingobacterium thalpophilum
58 2697529 2697720 - NZ_CP030848.1 Sphingobacterium hotanense
59 1235946 1236140 + NZ_LS483447.1 Porphyromonas crevioricanis
60 141971 142162 - NZ_CP015402.2 Muribaculum intestinale
61 2610727 2610918 + NC_017464.1 Ignavibacterium album JCM 16511
62 3344134 3344310 + NZ_AP018042.1 Labilibaculum antarcticum
63 512187 512378 + NC_017770.1 Solitalea canadensis DSM 3403
64 410223 410414 + NC_014370.1 Prevotella melaninogenica ATCC 25845
65 388829 389020 + NZ_CP023863.1 Prevotella jejuni
66 1354888 1355082 + NC_014655.1 Leadbetterella byssophila DSM 17132
67 2705740 2705931 + NC_018011.1 Alistipes finegoldii DSM 17242
68 2055075 2055266 + NC_014734.1 Paludibacter propionicigenes WB4
69 1609027 1609218 - NC_016599.1 Owenweeksia hongkongensis DSM 17368
70 3867691 3867882 - NZ_CP015401.2 Bacteroides caecimuris
71 699770 699961 - NZ_CP040530.1 Bacteroides thetaiotaomicron
72 3430480 3430671 - NZ_CP012938.1 Bacteroides ovatus
73 4709415 4709606 - NZ_LN877293.1 Bacteroides fragilis
74 2378218 2378412 + NZ_CP011071.1 Muricauda lutaonensis
75 103770 103961 - NZ_CP024727.1 Prevotella intermedia
76 2528323 2528520 - NZ_CP022957.1 Maribacter cobaltidurans
77 1174233 1174424 - NZ_CP012074.1 Prevotella fusca JCM 17724
78 1121818 1122009 - NC_009614.1 Phocaeicola vulgatus ATCC 8482
79 1124478 1124669 - NZ_LR699004.1 Phocaeicola dorei
80 2874088 2874279 + NZ_LR134384.1 Prevotella oris
81 2219030 2219221 - NZ_LR215980.1 Paraprevotella xylaniphila YIT 11841
82 1864568 1864762 + NZ_CP022743.1 Mucilaginibacter xinganensis
83 3301865 3302056 - NZ_CP069440.1 Phocaeicola coprophilus
84 807078 807275 + NZ_AP017422.1 Filimonas lacunae
85 5206614 5206811 + NZ_CP011390.1 Flavisolibacter tropicus
86 151013 151210 - NZ_CP042435.1 Panacibacter ginsenosidivorans
87 616897 617094 - NZ_CP032489.1 Arachidicoccus soli
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_CP048222.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00589.24 0.85 74 74.0 same-strand Phage integrase family
2 PF02899.19 0.84 73 74 same-strand Phage integrase, N-terminal SAM-like domain
3 PF13495.8 0.85 74 74.0 same-strand Phage integrase, N-terminal SAM-like domain
4 PF02482.21 0.75 65 981 same-strand Sigma 54 modulation protein / S30EA ribosomal protein
++ More..