Result : EXP02029
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02029 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 31824 |
| Right | 31967 |
| Strand | - |
| Nucleotide Sequence | ATGGCTGATTCTGCGCTGCAGCAGCAACTCGACGAGGTGCGGGCTCTGCTCACTCGAGCGCGAGAATTGTTCGGCCCCAATCCGATCGAGCCGCCCACCGACATCGCACCCGATCCCGACAGCACCAAGACCTGGCTCATCTAG |
| Sequence | MADSALQQQLDEVRALLTRARELFGPNPIEPPTDIAPDPDSTKTWLI |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | P0DMM2 |
| ORF Length (Amino Acid) | 47 |
++ More..
| Conservation Analysis |
No. of Species: 36
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 31757 | 31900 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 31824 | 31967 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 2138031 | 2138174 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 4 | 3982168 | 3982311 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 5 | 41366 | 41509 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 6 | 2630747 | 2630890 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 7 | 3654735 | 3654878 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 8 | 4075333 | 4075476 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 9 | 44325 | 44468 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 10 | 4268205 | 4268348 | + | NZ_AP022582.1 | Mycobacterium seoulense |
| 11 | 1528811 | 1528954 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 12 | 43103 | 43246 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 13 | 715207 | 715350 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 14 | 46187 | 46330 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 15 | 4517469 | 4517612 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 16 | 36670 | 36813 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 17 | 3591399 | 3591542 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 18 | 3905705 | 3905848 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 19 | 42798 | 42941 | - | NC_016948.1 | Mycobacterium paraintracellulare |
| 20 | 42872 | 43015 | - | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 21 | 4399260 | 4399403 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 22 | 48761 | 48904 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 23 | 49171 | 49314 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 24 | 3283084 | 3283227 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 25 | 5751210 | 5751353 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 26 | 1812626 | 1812769 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 27 | 30254 | 30397 | - | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 28 | 3337806 | 3337949 | + | NZ_AP022569.1 | Mycobacterium cookii |
| 29 | 4227661 | 4227804 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 30 | 5515532 | 5515675 | - | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 31 | 63184 | 63327 | - | NZ_LR134355.1 | Mycolicibacterium chitae |
| 32 | 1812232 | 1812375 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 33 | 2301919 | 2302056 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 34 | 1614023 | 1614148 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 35 | 5797276 | 5797401 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 36 | 2900195 | 2900344 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00877.21 | 0.94 | 34 | 2568.5 | opposite-strand | NlpC/P60 family |
| 2 | PF10774.11 | 1.0 | 36 | 1946.0 | opposite-strand | Domain of unknown function (DUF4226) |
| 3 | PF10824.10 | 1.0 | 36 | 318.0 | opposite-strand | Excreted virulence factor EspC, type VII ESX diderm |
| 4 | PF10904.10 | 0.94 | 34 | 6.5 | opposite-strand | Protein of unknown function (DUF2694) |
| 5 | PF18645.3 | 0.86 | 31 | 149 | opposite-strand | Family of unknown function (DUF5631) |
| 6 | PF18646.3 | 0.86 | 31 | 149 | opposite-strand | Family of unknown function (DUF5632) |
| 7 | PF10921.10 | 0.86 | 31 | 1524 | opposite-strand | Protein of unknown function (DUF2710) |
++ More..