Result : EXP02022
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02022 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 2680884 |
| Right | 2681024 |
| Strand | - |
| Nucleotide Sequence | GTGCCGATCACGAAGTTCAAGGCGAAGCCAACCACCATGAACCCAACGATGGCGCCGACGTTGGACGGCTTGATCTTGGCGAGTTCTTCGCCGCCGTGCCAACCGATGGCCAGCAGCAGATACAGGGTTAGGCCCTGGTAG |
| Sequence | VPITKFKAKPTTMNPTMAPTLDGLILASSSPPCQPMASSRYRVRPW |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 24
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2739497 | 2739637 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 2680884 | 2681024 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 2022512 | 2022646 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 4 | 3851180 | 3851314 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 5 | 2026597 | 2026734 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 6 | 1693221 | 1693352 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 7 | 1941970 | 1942101 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 8 | 5579453 | 5579593 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 9 | 130783 | 130914 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 10 | 1663790 | 1663912 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 11 | 2404674 | 2404796 | - | NZ_AP022606.1 | Mycobacterium branderi |
| 12 | 600201 | 600344 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 13 | 2238817 | 2238939 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 14 | 2240284 | 2240400 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 15 | 1689006 | 1689149 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 16 | 792036 | 792167 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 17 | 1687548 | 1687667 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 18 | 5822508 | 5822645 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 19 | 2363819 | 2363941 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 20 | 2365289 | 2365405 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 21 | 1710312 | 1710443 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 22 | 2110709 | 2110831 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 23 | 5904221 | 5904364 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 24 | 3819737 | 3819862 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 25 | 3440634 | 3440759 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 26 | 3719935 | 3720072 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 27 | 3594707 | 3594844 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 28 | 394176 | 394310 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 29 | 246628 | 246747 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 30 | 1698895 | 1699026 | - | NZ_AP022562.1 | Mycobacterium novum |
| 31 | 258852 | 258983 | + | NC_015576.1 | Mycolicibacter sinensis |
| 32 | 730971 | 731105 | + | NZ_CP029543.1 | Mycobacterium leprae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00425.20 | 0.71 | 17 | 967.0 | same-strand | chorismate binding enzyme |
| 2 | PF05982.14 | 0.96 | 23 | -125 | opposite-strand | Na+-dependent bicarbonate transporter superfamily |
| 3 | PF04055.23 | 0.67 | 16 | 992 | same-strand | Radical SAM superfamily |
| 4 | PF01077.24 | 0.62 | 15 | 2597.0 | opposite-strand | Nitrite and sulphite reductase 4Fe-4S domain |
| 5 | PF03460.19 | 0.62 | 15 | 2597.0 | opposite-strand | Nitrite/Sulfite reductase ferredoxin-like half domain |
| 6 | PF01507.21 | 0.62 | 15 | 4261.0 | opposite-strand | Phosphoadenosine phosphosulfate reductase family |
++ More..