Result : B3EU50
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S15 |
| NCBI Accession ID | CP001102.1 |
| Organism | Amoebophilus asiaticus (strain 5a2) |
| Left | 15554 |
| Right | 15829 |
| Strand | + |
| Nucleotide Sequence | ATGGCTTTAAATAAAGAGGATAAAAAAGATATATTTTTAACCTATAGTGCTAAGAATGTGGCACAAGACACAGGCTCTCCAGAGTCACAAATTGCCTTATTTAGTAACAGAATCACATATTTAACGGAACATCTTAAACAGTACCCTAAGGATAAAGCTTCTAGGTTAGGGCTTATTAAGCTCGTTGGTAAACGGAAAAAACAATTAACTTATTTACAAAATACAGCCATAGAACGATACAGAGATATCATAGTAAAGCTTGGCATACGTAAATAG |
| Sequence | MALNKEDKKDIFLTYSAKNVAQDTGSPESQIALFSNRITYLTEHLKQYPKDKASRLGLIKLVGKRKKQLTYLQNTAIERYRDIIVKLGIRK |
| Source of smORF | Swiss-Prot |
| Function | One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it helps nucleate assembly of the platform of the 30S subunit by binding and bridging several RNA helices of the 16S rRNA. {ECO:0000255|HAMAP-Rule:MF_01343}.; Forms an intersubunit bridge (bridge B4) with the 23S rRNA of the 50S subunit in the ribosome. {ECO:0000255|HAMAP-Rule:MF_01343}. |
| Pubmed ID | 20023027 |
| Domain | CDD:412325 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | B3EU50 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 443
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 5359577 | 5359846 | - | NC_015703.1 | Runella slithyformis DSM 19594 |
| 2 | 5035151 | 5035426 | + | NZ_CP055156.1 | Adhaeribacter swui |
| 3 | 3091387 | 3091662 | + | NZ_CP044285.1 | Hymenobacter baengnokdamensis |
| 4 | 2096246 | 2096521 | - | NC_008255.1 | Cytophaga hutchinsonii ATCC 33406 |
| 5 | 516164 | 516439 | + | NZ_CP047897.1 | Nibribacter ruber |
| 6 | 2504874 | 2505149 | + | NZ_CP055153.1 | Adhaeribacter radiodurans |
| 7 | 4574977 | 4575252 | - | NZ_CP012643.1 | Rufibacter tibetensis |
| 8 | 2413458 | 2413733 | + | NZ_CP007145.1 | Hymenobacter swuensis DY53 |
| 9 | 903858 | 904133 | + | NZ_CP048106.1 | Pontibacter pudoricolor |
| 10 | 4633345 | 4633620 | - | NZ_CP014766.1 | Pontibacter akesuensis |
| 11 | 1383350 | 1383625 | - | NZ_CP029145.1 | Hymenobacter nivis |
| 12 | 2721255 | 2721530 | - | NZ_CP012836.1 | Algoriphagus sanaruensis |
| 13 | 1131027 | 1131302 | + | NZ_CP021235.1 | Pontibacter actiniarum |
| 14 | 4587235 | 4587510 | - | NZ_CP040896.1 | Hymenobacter jejuensis |
| 15 | 2445242 | 2445517 | - | NZ_CP037922.1 | Hymenobacter radiodurans |
| 16 | 303496 | 303771 | - | NZ_CP047984.1 | Pontibacter russatus |
| 17 | 1092448 | 1092723 | - | NZ_CP032317.1 | Hymenobacter oligotrophus |
| 18 | 1905192 | 1905467 | - | NZ_CP010777.1 | Rufibacter radiotolerans |
| 19 | 644378 | 644647 | + | NZ_CP021904.1 | Alkalitalea saponilacus |
| 20 | 417123 | 417392 | + | NC_008639.1 | Chlorobium phaeobacteroides DSM 266 |
| 21 | 3665420 | 3665695 | + | NC_015914.1 | Cyclobacterium marinum DSM 745 |
| 22 | 3705583 | 3705858 | + | NZ_CP012040.1 | Cyclobacterium amurskyense |
| 23 | 4031982 | 4032257 | + | NZ_CP009621.1 | Pontibacter korlensis |
| 24 | 66486 | 66761 | + | NZ_CP050954.1 | Hymenobacter sp. BT18 |
| 25 | 348749 | 349018 | - | NZ_LR134476.1 | Trueperella bialowiezensis |
| 26 | 3560533 | 3560808 | - | NZ_CP013909.1 | Hymenobacter sedentarius |
| 27 | 1351519 | 1351788 | - | NZ_CP011312.1 | Corynebacterium kutscheri |
| 28 | 837498 | 837773 | - | NZ_CP048222.1 | Rhodocytophaga rosea |
| 29 | 283013 | 283288 | + | NC_014759.1 | Marivirga tractuosa DSM 4126 |
| 30 | 4829380 | 4829655 | + | NZ_CP050063.1 | Spirosoma aureum |
| 31 | 1817904 | 1818179 | - | NZ_CP014263.1 | Spirosoma montaniterrae |
| 32 | 3582454 | 3582717 | + | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 33 | 1183882 | 1184151 | + | NZ_LR134404.1 | Weeksella virosa |
| 34 | 4064685 | 4064960 | + | NC_019904.1 | Echinicola vietnamensis DSM 17526 |
| 35 | 4319397 | 4319672 | - | NZ_CP040106.1 | Echinicola rosea |
| 36 | 3918727 | 3919002 | - | NZ_CP020104.1 | Spirosoma aerolatum |
| 37 | 3566697 | 3566966 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 38 | 2841801 | 2842076 | + | NZ_CP053435.1 | Spirosoma taeanense |
| 39 | 1449352 | 1449615 | - | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 40 | 1805552 | 1805821 | - | NZ_AP014564.1 | Ichthyobacterium seriolicida |
| 41 | 1957289 | 1957552 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 42 | 2950086 | 2950361 | + | NC_018010.1 | Belliella baltica DSM 15883 |
| 43 | 85893 | 86168 | - | NZ_CP030041.1 | Echinicola strongylocentroti |
| 44 | 3978519 | 3978794 | - | NZ_CP034562.1 | Flammeovirga pectinis |
| 45 | 45049 | 45318 | - | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 46 | 648979 | 649248 | + | NZ_CP014337.1 | Elizabethkingia bruuniana |
| 47 | 8145728 | 8145997 | + | NZ_CP031142.1 | Saccharopolyspora pogona |
| 48 | 1806059 | 1806328 | - | NZ_CP015067.2 | Elizabethkingia anophelis |
| 49 | 341050 | 341319 | + | NC_010803.1 | Chlorobium limicola DSM 245 |
| 50 | 301130 | 301405 | - | NZ_CP029480.1 | Arcticibacterium luteifluviistationis |
| 51 | 935397 | 935666 | + | NZ_CP034412.1 | Glutamicibacter creatinolyticus |
| 52 | 3719928 | 3720203 | + | NZ_CP020105.1 | Spirosoma rigui |
| 53 | 2539748 | 2540014 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 54 | 754964 | 755233 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 55 | 3541947 | 3542222 | - | NZ_CP025096.1 | Spirosoma pollinicola |
| 56 | 381136 | 381405 | - | NZ_CP007519.1 | Trueperella pyogenes |
| 57 | 1962933 | 1963202 | - | NZ_CP061007.1 | Saccharopolyspora spinosa |
| 58 | 2088176 | 2088451 | + | NZ_CP022295.1 | Nocardioides aromaticivorans |
| 59 | 1255388 | 1255663 | - | NC_013037.1 | Dyadobacter fermentans DSM 18053 |
| 60 | 6192033 | 6192308 | - | NZ_CP032382.1 | Chryseolinea soli |
| 61 | 1571739 | 1572008 | - | NZ_CP011541.1 | Corynebacterium epidermidicanis |
| 62 | 1771275 | 1771544 | - | NZ_CP033896.1 | Corynebacterium choanae |
| 63 | 2508935 | 2509198 | + | NZ_CP041345.1 | Tenuifilum thalassicum |
| 64 | 2580513 | 2580788 | + | NZ_AP019307.1 | Nocardioides baekrokdamisoli |
| 65 | 3636947 | 3637216 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 66 | 1164779 | 1165048 | + | NC_013172.1 | Brachybacterium faecium DSM 4810 |
| 67 | 134638 | 134913 | - | NZ_CP038436.1 | Nocardioides seonyuensis |
| 68 | 255921 | 256190 | + | NZ_CP017305.1 | Chlorobaculum limnaeum |
| 69 | 837210 | 837479 | + | NC_017045.1 | Riemerella anatipestifer ATCC 11845 = DSM 15868 |
| 70 | 2935470 | 2935745 | + | NZ_CP010429.1 | Spirosoma radiotolerans |
| 71 | 1637920 | 1638183 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 72 | 999043 | 999318 | - | NC_014655.1 | Leadbetterella byssophila DSM 17132 |
| 73 | 1957992 | 1958267 | - | NZ_CP041091.1 | Nocardioides sambongensis |
| 74 | 6301373 | 6301642 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 75 | 528268 | 528537 | + | NZ_CP069485.1 | Corynebacterium glucuronolyticum |
| 76 | 597187 | 597456 | - | NC_013223.1 | Desulfohalobium retbaense DSM 5692 |
| 77 | 984314 | 984583 | + | NZ_CP035299.1 | Corynebacterium pelargi |
| 78 | 1974885 | 1975154 | - | NC_004369.1 | Corynebacterium efficiens YS-314 |
| 79 | 15468891 | 15469157 | - | NZ_CP016211.1 | Minicystis rosea |
| 80 | 1811767 | 1812036 | - | NZ_CP009220.1 | Corynebacterium deserti GIMN1.010 |
| 81 | 675656 | 675919 | + | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 82 | 2021768 | 2022037 | - | NC_014168.1 | Segniliparus rotundus DSM 44985 |
| 83 | 1387582 | 1387851 | - | NC_017301.2 | Corynebacterium pseudotuberculosis C231 |
| 84 | 492569 | 492838 | - | NZ_LT906443.1 | Corynebacterium ulcerans |
| 85 | 257032 | 257301 | + | NC_002932.3 | Chlorobaculum tepidum TLS |
| 86 | 406617 | 406886 | + | NC_011059.1 | Prosthecochloris aestuarii DSM 271 |
| 87 | 2362181 | 2362450 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 88 | 1011182 | 1011451 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 89 | 3137107 | 3137394 | - | NC_018018.1 | Bernardetia litoralis DSM 6794 |
| 90 | 1498991 | 1499260 | - | NZ_LR738855.1 | Corynebacterium rouxii |
| 91 | 1482993 | 1483262 | - | NZ_LN831026.1 | Corynebacterium diphtheriae |
| 92 | 1394102 | 1394371 | - | NZ_CP033897.1 | Corynebacterium gerontici |
| 93 | 1099437 | 1099706 | + | NZ_CP033081.1 | Glutamicibacter nicotianae |
| 94 | 3588533 | 3588802 | + | NZ_CP042260.1 | Glutamicibacter halophytocola |
| 95 | 1154623 | 1154892 | + | NC_014550.1 | Glutamicibacter arilaitensis Re117 |
| 96 | 2225356 | 2225631 | + | NZ_CP009896.1 | Pimelobacter simplex |
| 97 | 1564454 | 1564711 | - | NZ_AP019822.1 | Pseudoleptotrichia goodfellowii |
| 98 | 1098450 | 1098725 | - | NZ_CP024727.1 | Prevotella intermedia |
| 99 | 2282777 | 2283046 | - | NZ_CP033724.1 | Clavibacter michiganensis subsp. michiganensis |
| 100 | 2215338 | 2215607 | - | NZ_AP017369.1 | Corynebacterium suranareeae |
| 101 | 1826103 | 1826372 | - | NZ_CP015622.1 | Corynebacterium crudilactis |
| 102 | 728281 | 728544 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 103 | 2177017 | 2177286 | - | NC_014216.1 | Desulfurivibrio alkaliphilus AHT 2 |
| 104 | 3092040 | 3092315 | - | NZ_CP059164.1 | Nocardioides ungokensis |
| 105 | 984909 | 985178 | + | NZ_CP033898.1 | Corynebacterium pseudopelargi |
| 106 | 1450604 | 1450840 | - | NZ_CP032364.1 | Lachnoanaerobaculum umeaense |
| 107 | 2546931 | 2547200 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 108 | 2774644 | 2774913 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 109 | 4812528 | 4812791 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 110 | 2630789 | 2631058 | - | NZ_CP023564.1 | Brachybacterium ginsengisoli |
| 111 | 757405 | 757668 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 112 | 1992541 | 1992810 | - | NZ_CP011542.1 | Corynebacterium mustelae |
| 113 | 1514571 | 1514837 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 114 | 1960344 | 1960613 | - | NC_011027.1 | Chlorobaculum parvum NCIB 8327 |
| 115 | 3673959 | 3674228 | - | NZ_CP010817.1 | Myroides profundi |
| 116 | 220404 | 220673 | - | NZ_CP009312.1 | Lawsonella clevelandensis |
| 117 | 8153959 | 8154228 | - | NZ_CP007155.1 | Kutzneria albida DSM 43870 |
| 118 | 706864 | 707127 | + | NZ_AP019829.2 | Leptotrichia wadei |
| 119 | 1188497 | 1188766 | - | NC_022198.1 | Corynebacterium argentoratense DSM 44202 |
| 120 | 1852655 | 1852927 | - | NZ_CP053837.1 | Aliarcobacter faecis |
| 121 | 1319676 | 1319945 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 122 | 3830380 | 3830646 | - | NZ_CP019646.1 | Limihaloglobus sulfuriphilus |
| 123 | 1775095 | 1775358 | - | NZ_AP019845.1 | Leptotrichia trevisanii |
| 124 | 528772 | 529041 | + | NZ_AP012331.1 | Bifidobacterium scardovii JCM 12489 = DSM 13734 |
| 125 | 2208771 | 2209037 | + | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 126 | 1540146 | 1540412 | + | NC_013501.1 | Rhodothermus marinus DSM 4252 |
| 127 | 996006 | 996275 | + | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 128 | 2346128 | 2346394 | + | NZ_CP022464.2 | Enterocloster bolteae |
| 129 | 2551666 | 2551935 | - | NC_015164.1 | Phocaeicola salanitronis DSM 18170 |
| 130 | 1864265 | 1864537 | - | NZ_CP054051.1 | Aliarcobacter cibarius |
| 131 | 461886 | 462155 | - | NZ_LT605205.1 | Proteiniphilum saccharofermentans |
| 132 | 2168072 | 2168341 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 133 | 1745509 | 1745775 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 134 | 3382516 | 3382785 | - | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 135 | 239446 | 239715 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 136 | 2560687 | 2560956 | + | NZ_LT906465.1 | Chryseobacterium taklimakanense |
| 137 | 766023 | 766292 | + | NC_012803.1 | Micrococcus luteus NCTC 2665 |
| 138 | 1746057 | 1746326 | - | NZ_CP009245.1 | Corynebacterium aquilae DSM 44791 |
| 139 | 2966122 | 2966391 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 140 | 657417 | 657683 | + | NZ_CP009761.1 | Parvimonas micra |
| 141 | 909994 | 910260 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 142 | 1044403 | 1044672 | + | NZ_CP035037.1 | Leucobacter muris |
| 143 | 4727053 | 4727322 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 144 | 1983220 | 1983489 | - | NC_007512.1 | Pelodictyon luteolum DSM 273 |
| 145 | 350636 | 350908 | + | NC_017187.1 | Aliarcobacter butzleri ED-1 |
| 146 | 2935986 | 2936255 | + | NZ_CP022316.1 | Brachybacterium avium |
| 147 | 847604 | 847870 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 148 | 1139887 | 1140156 | + | NZ_CP007451.1 | Draconibacterium orientale |
| 149 | 3693537 | 3693806 | - | NZ_LT608328.1 | Petrimonas mucosa |
| 150 | 1053493 | 1053762 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 151 | 1940659 | 1940928 | + | NC_015577.1 | Treponema azotonutricium ZAS-9 |
| 152 | 3658631 | 3658897 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 153 | 371749 | 372018 | + | NZ_CP006828.1 | Ornithobacterium rhinotracheale ORT-UMN 88 |
| 154 | 774399 | 774665 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 155 | 2648697 | 2648960 | - | NC_015275.1 | Cellulosilyticum lentocellum DSM 5427 |
| 156 | 2324506 | 2324775 | - | NZ_CP017774.1 | Flavobacterium commune |
| 157 | 1825286 | 1825552 | + | NC_007498.2 | Syntrophotalea carbinolica DSM 2380 |
| 158 | 305762 | 306031 | + | NZ_LT906459.1 | Odoribacter splanchnicus |
| 159 | 3690847 | 3691110 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 160 | 3430435 | 3430704 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 161 | 395879 | 396148 | - | NZ_LR134506.1 | Porphyromonas cangingivalis |
| 162 | 1163064 | 1163333 | + | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 163 | 2735263 | 2735538 | + | NZ_CP015079.1 | Nocardioides dokdonensis FR1436 |
| 164 | 2838352 | 2838621 | + | NZ_LN849456.1 | Devriesea agamarum |
| 165 | 436809 | 437078 | - | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 166 | 2168527 | 2168790 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 167 | 610205 | 610471 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 168 | 3090522 | 3090791 | - | NZ_CP033914.1 | Chryseobacterium shandongense |
| 169 | 1645169 | 1645441 | - | NZ_CP031367.1 | Aliarcobacter trophiarum LMG 25534 |
| 170 | 1780282 | 1780551 | - | NC_020506.1 | Corynebacterium callunae DSM 20147 |
| 171 | 80094 | 80357 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 172 | 2297467 | 2297736 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 173 | 1542708 | 1542977 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 174 | 1923917 | 1924186 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 175 | 2356907 | 2357176 | + | NZ_CP060716.1 | Leucobacter denitrificans |
| 176 | 2501047 | 2501316 | - | NC_015578.1 | Treponema primitia ZAS-2 |
| 177 | 2600340 | 2600603 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 178 | 1792001 | 1792267 | + | NC_007517.1 | Geobacter metallireducens GS-15 |
| 179 | 5568191 | 5568460 | - | NZ_LR134352.1 | Nocardia asteroides |
| 180 | 282629 | 282901 | + | NZ_CP032823.1 | Aliarcobacter cryaerophilus ATCC 43158 |
| 181 | 509343 | 509612 | + | NZ_CP012332.1 | Vulgatibacter incomptus |
| 182 | 2962938 | 2963201 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 183 | 1768529 | 1768795 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 184 | 2462192 | 2462461 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 185 | 3296986 | 3297252 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 186 | 1910293 | 1910562 | - | NZ_CP023049.2 | Chryseobacterium piperi |
| 187 | 420769 | 421038 | + | NZ_CP042429.1 | Corynebacterium nuruki S6-4 |
| 188 | 576314 | 576583 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 189 | 433316 | 433585 | - | NZ_CP049255.1 | Microbacterium endophyticum |
| 190 | 533721 | 533990 | + | NZ_CP031356.1 | Brachybacterium saurashtrense |
| 191 | 3369633 | 3369899 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 192 | 1206701 | 1206970 | + | NZ_CP006841.1 | Corynebacterium lactis RW2-5 |
| 193 | 1901167 | 1901436 | + | NZ_CP039934.1 | Myroides fluvii |
| 194 | 2341097 | 2341366 | - | NZ_CP018787.1 | Oxalobacter formigenes |
| 195 | 1593215 | 1593478 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 196 | 2056544 | 2056813 | - | NZ_AP022873.1 | Dissulfurispira thermophila |
| 197 | 2138713 | 2138982 | - | NZ_CP013195.1 | Prevotella enoeca |
| 198 | 1208736 | 1208957 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 199 | 1246075 | 1246350 | + | NZ_CP049257.1 | Nocardioides anomalus |
| 200 | 1111868 | 1112134 | + | NZ_CP019633.1 | Sedimentisphaera cyanobacteriorum |
| 201 | 1755556 | 1755825 | - | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 202 | 51932 | 52201 | - | NZ_CP032630.1 | Protaetiibacter intestinalis |
| 203 | 2866018 | 2866281 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 204 | 1393327 | 1393599 | - | NZ_CP011546.1 | Corynebacterium uterequi |
| 205 | 2375336 | 2375605 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 206 | 992671 | 992949 | + | NZ_CP026947.1 | Corynebacterium yudongzhengii |
| 207 | 3623994 | 3624263 | + | NZ_CP069440.1 | Phocaeicola coprophilus |
| 208 | 936865 | 937137 | + | NC_014810.2 | Helicobacter felis ATCC 49179 |
| 209 | 1315354 | 1315626 | - | NC_017735.1 | Helicobacter cetorum MIT 99-5656 |
| 210 | 1084407 | 1084676 | + | NZ_CP054494.1 | Flavobacterium columnare |
| 211 | 757390 | 757662 | - | NZ_CP053826.1 | Campylobacter curvus |
| 212 | 2184796 | 2185065 | + | NZ_CP069450.1 | Butyricimonas virosa |
| 213 | 916261 | 916539 | - | NZ_LR590484.1 | Sphingobacterium thalpophilum |
| 214 | 1662155 | 1662424 | + | NZ_CP011786.1 | Bifidobacterium actinocoloniiforme DSM 22766 |
| 215 | 665200 | 665466 | - | NZ_CP015519.1 | Syntrophotalea acetylenivorans |
| 216 | 4356583 | 4356846 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 217 | 692345 | 692566 | - | NZ_CP027226.1 | Fastidiosipila sanguinis |
| 218 | 897607 | 897876 | + | NZ_CP008944.1 | Corynebacterium atypicum |
| 219 | 365295 | 365570 | - | NZ_CP041146.1 | Nocardioides humi |
| 220 | 949174 | 949443 | - | NZ_LS483447.1 | Porphyromonas crevioricanis |
| 221 | 1154686 | 1154955 | - | NZ_AP022847.1 | Nitrosophilus alvini |
| 222 | 1897422 | 1897691 | + | NC_010729.1 | Porphyromonas gingivalis ATCC 33277 |
| 223 | 2963267 | 2963542 | + | NZ_CP045696.1 | Sodaliphilus pleomorphus |
| 224 | 602189 | 602458 | + | NZ_CP026923.1 | Pontimonas salivibrio |
| 225 | 1903790 | 1904059 | - | NZ_CP050995.1 | Chryseobacterium gallinarum |
| 226 | 1879739 | 1880008 | - | NZ_CP037933.1 | Flavobacterium nackdongense |
| 227 | 1616160 | 1616432 | - | NZ_AP019736.1 | Alistipes dispar |
| 228 | 4005566 | 4005802 | - | NZ_CP039126.1 | Blautia producta |
| 229 | 842732 | 843004 | + | NZ_LR027382.1 | Alistipes megaguti |
| 230 | 149464 | 149733 | - | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 231 | 1203235 | 1203504 | - | NC_009614.1 | Phocaeicola vulgatus ATCC 8482 |
| 232 | 1995719 | 1995988 | + | NZ_LR699004.1 | Phocaeicola dorei |
| 233 | 1327444 | 1327719 | + | NZ_CP007034.1 | Barnesiella viscericola DSM 18177 |
| 234 | 2326932 | 2327222 | - | NZ_CP045737.1 | Aeromicrobium yanjiei |
| 235 | 2351535 | 2351825 | - | NZ_CP026952.1 | Aeromicrobium chenweiae |
| 236 | 7061335 | 7061601 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 237 | 636577 | 636852 | + | NC_014370.1 | Prevotella melaninogenica ATCC 25845 |
| 238 | 681926 | 682201 | + | NZ_CP023863.1 | Prevotella jejuni |
| 239 | 2816887 | 2817153 | - | NZ_CP021023.1 | Sedimentisphaera salicampi |
| 240 | 1575188 | 1575457 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 241 | 985305 | 985577 | + | NZ_CP020867.1 | Campylobacter cuniculorum DSM 23162 = LMG 24588 |
| 242 | 3111228 | 3111497 | - | NZ_CP022957.1 | Maribacter cobaltidurans |
| 243 | 1150402 | 1150668 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 244 | 986910 | 987182 | - | NZ_AP019735.1 | Alistipes communis |
| 245 | 1379264 | 1379536 | - | NC_018011.1 | Alistipes finegoldii DSM 17242 |
| 246 | 2212759 | 2213025 | - | NZ_CP030356.1 | Salinibacter ruber |
| 247 | 2239650 | 2239913 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 248 | 1023650 | 1023919 | + | NZ_CP064760.1 | Microbacterium schleiferi |
| 249 | 2526453 | 2526722 | - | NZ_LR215980.1 | Paraprevotella xylaniphila YIT 11841 |
| 250 | 667911 | 668180 | - | NZ_CP035806.1 | Leucobacter triazinivorans |
| 251 | 66217 | 66471 | - | NZ_CP007389.1 | Thermosipho melanesiensis |
| 252 | 1806002 | 1806268 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 253 | 2317716 | 2317985 | - | NZ_CP027234.1 | Bacteroides heparinolyticus |
| 254 | 480132 | 480401 | - | NZ_LT996885.1 | Dialister massiliensis |
| 255 | 1181264 | 1181500 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 256 | 4754933 | 4755202 | + | NZ_CP032819.1 | Butyricimonas faecalis |
| 257 | 328847 | 329119 | + | NZ_CP032099.1 | Aliarcobacter skirrowii CCUG 10374 |
| 258 | 781184 | 781456 | - | NZ_AP023049.1 | Alistipes indistinctus |
| 259 | 1408002 | 1408271 | + | NZ_CP054140.1 | Desulfobulbus oligotrophicus |
| 260 | 2868036 | 2868305 | + | NZ_CP032624.1 | Gryllotalpicola protaetiae |
| 261 | 2020471 | 2020740 | + | NC_013162.1 | Capnocytophaga ochracea DSM 7271 |
| 262 | 368648 | 368929 | + | NC_015501.1 | Porphyromonas asaccharolytica DSM 20707 |
| 263 | 2793076 | 2793345 | - | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
| 264 | 2039957 | 2040196 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 265 | 482611 | 482883 | + | NZ_CP053835.1 | Arcobacter defluvii |
| 266 | 5032907 | 5033176 | + | NZ_LN877293.1 | Bacteroides fragilis |
| 267 | 1209009 | 1209278 | - | NC_011978.1 | Thermotoga neapolitana DSM 4359 |
| 268 | 156821 | 157090 | + | NC_014033.1 | Prevotella ruminicola 23 |
| 269 | 410968 | 411240 | + | NC_017379.1 | Helicobacter pylori Puno135 |
| 270 | 3321010 | 3321276 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 271 | 5291531 | 5291800 | + | NZ_LR134289.1 | Chryseobacterium gleum |
| 272 | 1328154 | 1328420 | + | NZ_CP035033.1 | Hydrogenovibrio thermophilus |
| 273 | 1150788 | 1151024 | + | NZ_CP030280.1 | Blautia argi |
| 274 | 3123529 | 3123798 | + | NC_014734.1 | Paludibacter propionicigenes WB4 |
| 275 | 3760348 | 3760611 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 276 | 307815 | 308081 | + | NC_017096.1 | Caldisericum exile AZM16c01 |
| 277 | 479951 | 480223 | + | NZ_CP053833.1 | Arcobacter cloacae |
| 278 | 2563446 | 2563715 | - | NZ_CP022379.1 | Capnocytophaga sputigena |
| 279 | 2716356 | 2716625 | + | NZ_CP022022.1 | Capnocytophaga endodontalis |
| 280 | 1288286 | 1288558 | + | NZ_CP012541.1 | Campylobacter concisus |
| 281 | 696987 | 697259 | - | NZ_AP023212.1 | Hydrogenimonas urashimensis |
| 282 | 2134937 | 2135206 | - | NZ_CP029463.1 | Flavobacterium sediminis |
| 283 | 2285597 | 2285863 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 284 | 491400 | 491672 | + | NZ_CP032097.1 | Arcobacter ellisii |
| 285 | 2215389 | 2215655 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 286 | 1164704 | 1164976 | + | NZ_CP053828.1 | Campylobacter hyointestinalis subsp. lawsonii |
| 287 | 1200830 | 1201096 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 288 | 709735 | 709998 | + | NZ_CP029256.1 | Christensenella minuta |
| 289 | 2426714 | 2426983 | + | NC_017025.1 | Flavobacterium indicum GPTSA100-9 = DSM 17447 |
| 290 | 868544 | 868816 | + | NZ_CP007770.1 | Campylobacter insulaenigrae NCTC 12927 |
| 291 | 454474 | 454746 | + | NZ_CP031219.1 | Malaciobacter mytili LMG 24559 |
| 292 | 2002994 | 2003263 | - | NZ_CP009976.1 | Cellulophaga baltica 18 |
| 293 | 1575038 | 1575310 | - | NZ_CP014991.1 | Helicobacter himalayensis |
| 294 | 317197 | 317466 | - | NZ_CP022378.1 | Capnocytophaga cynodegmi |
| 295 | 4506143 | 4506412 | - | NZ_CP019288.1 | Kordia antarctica |
| 296 | 422916 | 423188 | + | NZ_CP030944.1 | Arcobacter aquimarinus |
| 297 | 1642091 | 1642360 | + | NC_016599.1 | Owenweeksia hongkongensis DSM 17368 |
| 298 | 1149462 | 1149728 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 299 | 534250 | 534516 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 300 | 631146 | 631415 | - | NZ_CP015199.1 | Chryseobacterium glaciei |
| 301 | 2473067 | 2473333 | + | NZ_CP019791.1 | Anaerohalosphaera lusitana |
| 302 | 578208 | 578468 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 303 | 1770578 | 1770853 | - | NC_014762.1 | Sulfuricurvum kujiense DSM 16994 |
| 304 | 3909647 | 3909916 | + | NZ_CP022986.1 | Chryseobacterium camelliae |
| 305 | 3193102 | 3193371 | + | NZ_CP015125.1 | Dokdonia donghaensis DSW-1 |
| 306 | 2739998 | 2740261 | - | NC_015064.1 | Granulicella tundricola MP5ACTX9 |
| 307 | 1621933 | 1622196 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 308 | 3747014 | 3747283 | + | NZ_CP054012.1 | Parabacteroides distasonis |
| 309 | 453963 | 454235 | + | NZ_CP032100.1 | Arcobacter suis CECT 7833 |
| 310 | 2142853 | 2143131 | + | NC_013061.1 | Pedobacter heparinus DSM 2366 |
| 311 | 1695353 | 1695625 | - | NZ_CP036246.2 | [Arcobacter] porcinus |
| 312 | 993306 | 993578 | - | NC_008229.1 | Helicobacter acinonychis str. Sheeba |
| 313 | 726699 | 726968 | + | NZ_CP061703.1 | Mesoflavibacter profundi |
| 314 | 522724 | 522996 | - | NC_004917.1 | Helicobacter hepaticus ATCC 51449 |
| 315 | 1179000 | 1179269 | - | NC_014933.1 | Bacteroides helcogenes P 36-108 |
| 316 | 3196633 | 3196911 | - | NZ_CP032869.1 | Mucilaginibacter celer |
| 317 | 2576261 | 2576554 | + | NC_016940.1 | Saprospira grandis str. Lewin |
| 318 | 950509 | 950784 | - | NZ_CP012074.1 | Prevotella fusca JCM 17724 |
| 319 | 535797 | 536063 | + | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 320 | 1712901 | 1713167 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 321 | 1107697 | 1107963 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 322 | 1700357 | 1700626 | - | NZ_CP017479.1 | Flavobacterium gilvum |
| 323 | 562791 | 563060 | + | NZ_CP019419.1 | Polaribacter reichenbachii |
| 324 | 990744 | 991016 | + | NZ_CP053848.1 | Campylobacter ornithocola |
| 325 | 1882993 | 1883262 | + | NZ_CP018155.1 | Tenacibaculum todarodis |
| 326 | 602160 | 602438 | + | NZ_CP071878.1 | Mucilaginibacter gossypii |
| 327 | 1221858 | 1222121 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 328 | 3866059 | 3866337 | - | NZ_CP042436.1 | Mucilaginibacter ginsenosidivorans |
| 329 | 1938078 | 1938347 | + | NZ_CP027231.1 | Bacteroides zoogleoformans |
| 330 | 395571 | 395840 | + | NZ_LT906449.1 | Capnocytophaga haemolytica |
| 331 | 1741686 | 1741955 | - | NZ_CP007202.1 | Siansivirga zeaxanthinifaciens CC-SAMT-1 |
| 332 | 1584798 | 1585064 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 333 | 2000932 | 2001201 | + | NZ_CP061813.1 | Polaribacter haliotis |
| 334 | 4129190 | 4129459 | + | NZ_LT899436.1 | Tenacibaculum jejuense |
| 335 | 1414745 | 1415014 | + | NZ_CP017812.1 | Boudabousia tangfeifanii |
| 336 | 397341 | 397613 | + | NZ_AP018676.1 | Helicobacter cinaedi |
| 337 | 904352 | 904624 | + | NC_012039.1 | Campylobacter lari RM2100 |
| 338 | 2336375 | 2336653 | - | NZ_CP024091.1 | Pedobacter ginsengisoli |
| 339 | 3002739 | 3003008 | + | NZ_AP018042.1 | Labilibaculum antarcticum |
| 340 | 3020911 | 3021180 | + | NZ_CP014224.1 | Wenyingzhuangia fucanilytica |
| 341 | 2192484 | 2192747 | + | NC_018014.1 | Terriglobus roseus DSM 18391 |
| 342 | 1178688 | 1178960 | + | NZ_CP007773.1 | Campylobacter subantarcticus LMG 24377 |
| 343 | 872461 | 872733 | + | NZ_CP020478.1 | Campylobacter helveticus |
| 344 | 1150960 | 1151232 | + | NZ_CP053831.1 | Campylobacter mucosalis |
| 345 | 2109923 | 2110186 | - | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 346 | 399862 | 400137 | + | NZ_CP044344.1 | Nocardioides cynanchi |
| 347 | 1623588 | 1623857 | + | NZ_CP034161.1 | Epilithonimonas vandammei |
| 348 | 1072139 | 1072411 | + | NZ_CP015578.1 | Campylobacter lanienae NCTC 13004 |
| 349 | 1283512 | 1283796 | - | NC_015177.1 | Pseudopedobacter saltans DSM 12145 |
| 350 | 945728 | 946000 | + | NZ_CP053825.1 | Campylobacter armoricus |
| 351 | 1574268 | 1574537 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 352 | 1421797 | 1422063 | - | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 353 | 545399 | 545671 | - | NZ_LN907858.1 | Helicobacter typhlonius |
| 354 | 872667 | 872933 | + | NC_011244.1 | Borrelia recurrentis A1 |
| 355 | 1162425 | 1162694 | - | NC_016001.1 | Flavobacterium branchiophilum FL-15 |
| 356 | 2538594 | 2538863 | - | NZ_CP013355.1 | Lutibacter profundi |
| 357 | 886280 | 886552 | + | NZ_CP007774.1 | Campylobacter volucris LMG 24379 |
| 358 | 55546 | 55812 | - | NZ_CP024333.1 | Borrelia miyamotoi |
| 359 | 596463 | 596738 | + | NZ_CP041406.1 | Sulfurimonas paralvinellae |
| 360 | 1918311 | 1918577 | + | NZ_CP010802.1 | Desulfuromonas soudanensis |
| 361 | 3147610 | 3147885 | - | NZ_CP015402.2 | Muribaculum intestinale |
| 362 | 647559 | 647828 | + | NZ_CP058595.1 | Costertonia aggregata |
| 363 | 1102472 | 1102744 | + | NZ_CP059443.1 | Campylobacter fetus |
| 364 | 961647 | 961913 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 365 | 862191 | 862457 | + | NZ_CP011060.1 | Borrelia hermsii CC1 |
| 366 | 1458526 | 1458795 | - | NZ_CP053698.1 | Empedobacter stercoris |
| 367 | 2878168 | 2878437 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 368 | 878668 | 878934 | + | NZ_CP028884.1 | Borrelia turcica IST7 |
| 369 | 1018457 | 1018729 | + | NC_005090.1 | Wolinella succinogenes DSM 1740 |
| 370 | 1429034 | 1429303 | - | NZ_CP022389.1 | Capnocytophaga canimorsus |
| 371 | 1063658 | 1063924 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 372 | 2563 | 2835 | + | NZ_CP063079.1 | Campylobacter peloridis |
| 373 | 1696140 | 1696400 | + | NZ_CP012900.1 | Stenotrophomonas acidaminiphila |
| 374 | 1421179 | 1421445 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 375 | 789274 | 789546 | - | NZ_CP053849.1 | Campylobacter upsaliensis RM3940 |
| 376 | 2472989 | 2473210 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 377 | 3961607 | 3961885 | + | NZ_CP030848.1 | Sphingobacterium hotanense |
| 378 | 536438 | 536707 | - | NZ_CP022386.1 | Capnocytophaga gingivalis |
| 379 | 13609 | 13878 | - | NZ_CP042476.1 | Antarcticibacterium arcticum |
| 380 | 1581888 | 1582157 | - | NZ_CP041637.1 | Formosa sediminum |
| 381 | 2539688 | 2539957 | - | NZ_CP025938.1 | Tamlana carrageenivorans |
| 382 | 406526 | 406804 | - | NZ_CP049246.1 | Sphingobacterium lactis |
| 383 | 2805932 | 2806201 | + | NZ_LR134384.1 | Prevotella oris |
| 384 | 1371943 | 1372209 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 385 | 858351 | 858617 | + | NZ_CP007022.1 | Borrelia parkeri HR1 |
| 386 | 858502 | 858768 | + | NC_008710.1 | Borrelia turicatae 91E135 |
| 387 | 3186741 | 3187010 | - | NZ_CP023563.1 | Brachybacterium vulturis |
| 388 | 283827 | 284096 | - | NZ_CP022387.1 | Capnocytophaga stomatis |
| 389 | 289959 | 290228 | + | NZ_CP042831.1 | Flavobacterium alkalisoli |
| 390 | 840162 | 840428 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 391 | 898450 | 898716 | + | NZ_LR134524.1 | Peptoniphilus harei |
| 392 | 197528 | 197797 | - | NZ_CP068161.1 | Corynebacterium propinquum |
| 393 | 1396560 | 1396838 | - | NC_018002.1 | Sulfurospirillum barnesii SES-3 |
| 394 | 1298089 | 1298355 | - | NZ_CP020414.2 | Leptospira interrogans serovar Copenhageni |
| 395 | 611825 | 612097 | + | NZ_LS483446.1 | Helicobacter mustelae |
| 396 | 2532783 | 2533052 | + | NZ_CP020822.1 | Tenacibaculum maritimum |
| 397 | 2938002 | 2938271 | + | NZ_CP019352.1 | Lacinutrix venerupis |
| 398 | 1090167 | 1090439 | + | NZ_AP014724.1 | Sulfurospirillum cavolei |
| 399 | 1634560 | 1634829 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 400 | 1647336 | 1647605 | + | NZ_CP025791.1 | Flavivirga eckloniae |
| 401 | 1377414 | 1377686 | - | NC_013512.1 | Sulfurospirillum deleyianum DSM 6946 |
| 402 | 511859 | 512128 | + | NZ_CP035495.1 | Xylanimonas allomyrinae |
| 403 | 3144341 | 3144610 | - | NZ_CP017477.1 | Polaribacter vadi |
| 404 | 1562336 | 1562614 | - | NZ_CP054139.1 | Mucilaginibacter mali |
| 405 | 3344190 | 3344459 | + | NZ_CP058952.1 | Chitinibacter fontanus |
| 406 | 1561896 | 1562165 | - | NZ_CP007790.1 | Corynebacterium marinum DSM 44953 |
| 407 | 2580203 | 2580472 | - | NZ_CP049934.1 | Leucobacter insecticola |
| 408 | 7709799 | 7710077 | - | NZ_CP042437.1 | Mucilaginibacter ginsenosidivorax |
| 409 | 3030643 | 3030912 | + | NZ_CP011125.1 | Sandaracinus amylolyticus |
| 410 | 2852159 | 2852425 | - | NZ_CP026671.1 | Leptospira borgpetersenii serovar Ceylonica |
| 411 | 3576087 | 3576353 | - | NZ_CP030142.1 | Leptospira mayottensis |
| 412 | 1885496 | 1885762 | + | NZ_CP040840.1 | Leptospira weilii |
| 413 | 1516748 | 1517017 | + | NZ_CP031425.1 | Microbacterium foliorum |
| 414 | 719423 | 719692 | + | NC_015167.1 | Cellulophaga lytica DSM 7489 |
| 415 | 1003251 | 1003523 | - | NZ_CP035946.1 | Campylobacter canadensis |
| 416 | 1320048 | 1320314 | - | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 417 | 733180 | 733440 | + | NZ_CP029556.1 | Lysobacter oculi |
| 418 | 2652829 | 2653113 | - | NZ_CP060723.1 | Pedobacter roseus |
| 419 | 1776242 | 1776505 | - | NZ_LT635772.1 | Anaerococcus mediterraneensis |
| 420 | 1851589 | 1851867 | - | NZ_CP007201.1 | Sulfurospirillum multivorans DSM 12446 |
| 421 | 22243 | 22518 | + | NZ_CP063087.1 | Helicobacter winghamensis |
| 422 | 1719952 | 1720230 | - | NZ_CP017111.1 | Sulfurospirillum halorespirans DSM 13726 |
| 423 | 1842134 | 1842403 | - | NZ_CP012117.1 | Dermabacter vaginalis |
| 424 | 338613 | 338882 | + | NZ_LT906481.1 | Corynebacterium urealyticum |
| 425 | 2632186 | 2632446 | - | NZ_CP007810.1 | Xanthomonas oryzae pv. oryzicola |
| 426 | 4220893 | 4221162 | - | NZ_CP011801.1 | Nitrospira moscoviensis |
| 427 | 1683711 | 1683971 | + | NZ_LT853882.1 | Xanthomonas fragariae |
| 428 | 3176672 | 3176932 | - | NZ_CP048044.1 | Xanthomonas citri |
| 429 | 1897590 | 1897850 | + | NZ_CP058243.1 | Xanthomonas campestris pv. raphani |
| 430 | 3056703 | 3056963 | - | NZ_CP072268.1 | Xanthomonas euvesicatoria pv. alfalfae |
| 431 | 2980733 | 2980993 | - | NZ_CP028127.1 | Xanthomonas vasicola pv. vasculorum |
| 432 | 708847 | 709116 | - | NZ_LT828648.1 | Nitrospira japonica |
| 433 | 2941772 | 2942038 | - | NZ_CP027792.1 | Pulveribacter suum |
| 434 | 2151698 | 2151967 | - | NZ_CP049933.1 | Leucobacter coleopterorum |
| 435 | 2144086 | 2144355 | - | NZ_CP028136.1 | Gramella fulva |
| 436 | 290910 | 291167 | + | NZ_CP053627.1 | Xylella taiwanensis |
| 437 | 7729182 | 7729451 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 438 | 1882874 | 1883143 | + | NZ_CP011853.1 | Gordonia phthalatica |
| 439 | 868370 | 868639 | - | NZ_CP049863.1 | Leucobacter viscericola |
| 440 | 6745029 | 6745298 | + | NZ_CP036292.1 | Rosistilla oblonga |
| 441 | 2295613 | 2295882 | + | NC_013441.1 | Gordonia bronchialis DSM 43247 |
| 442 | 9365931 | 9366200 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 443 | 2102913 | 2103182 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015703.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01138.23 | 0.74 | 330 | 175.0 | same-strand | 3' exoribonuclease family, domain 1 |
| 2 | PF03725.17 | 0.64 | 285 | 162 | same-strand | 3' exoribonuclease family, domain 2 |
| 3 | PF00575.25 | 0.74 | 329 | 182.5 | same-strand | S1 RNA binding domain |
| 4 | PF00013.31 | 0.72 | 317 | 177 | same-strand | KH domain |
| 5 | PF03726.16 | 0.72 | 321 | 175 | same-strand | Polyribonucleotide nucleotidyltransferase, RNA binding domain |
++ More..