ProsmORF-pred
Result : A0R0N3
Protein Information
Information Type Description
Protein name Antitoxin MazE
NCBI Accession ID CP000480.1
Organism Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis)
Left 4528883
Right 4529092
Strand +
Nucleotide Sequence ATGACTCCCGCGCGTGACCGAGTACGCCGACATCGCGAGCGGCTGCGGCGACAAGGTCTGCGGCCGGTGCAGATCTGGGTCCCCGACGTGAATGCACCCGAATTTCGCCGGGAGGCGCACCGGCAGTCTGAGTTGGTCGCCGCCGGCGAGCATGAGGCCGAAGATCAAGCTTTCGTCGACGCGATCTCCGTCGACTGGGACGACGCCTAA
Sequence MTPARDRVRRHRERLRRQGLRPVQIWVPDVNAPEFRREAHRQSELVAAGEHEAEDQAFVDAISVDWDDA
Source of smORF Swiss-Prot
Function Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin MazF. In M.smegmatis 3 TA systems (VapB-VapC, MazE-MazF and Phd-Doc) may be involved in monitoring the nutritional supply and physiological state of the cell, linking catabolic with anabolic reactions. {ECO:0000269|Pubmed:22199354}.
Pubmed ID 17295914 18955433 22199354
Domain
Functional Category Antitoxin_type_2
Uniprot ID A0R0N3
ORF Length (Amino Acid) 69
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 39
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 4528956 4529165 + NZ_LN831039.1 Mycolicibacterium smegmatis
2 761679 761864 - NZ_CP016617.1 Microvirga ossetica
3 2006072 2006284 - NZ_AP022570.1 Mycolicibacterium poriferae
4 1195551 1195736 + NC_010581.1 Beijerinckia indica subsp. indica ATCC 9039
5 1054627 1054833 - NZ_CP016428.1 Bradyrhizobium icense
6 1125007 1125192 + NC_011894.1 Methylobacterium nodulans ORS 2060
7 2427897 2428082 - NZ_CP058354.1 Bradyrhizobium japonicum
8 4410884 4411069 + NZ_AP014946.1 Variibacter gotjawalensis
9 4931725 4931949 - NZ_CP015367.1 Methylobacterium phyllosphaerae
10 2013696 2013935 + NZ_CP030265.1 Skermanella pratensis
11 2539717 2539914 + NZ_CP011971.1 Steroidobacter denitrificans
12 22780 22968 + NZ_CP029178.1 Acidibrevibacterium fodinaquatile
13 3715074 3715259 - NC_009511.1 Sphingomonas wittichii RW1
14 1817990 1818169 - NC_020520.1 Ilumatobacter coccineus YM16-304
15 1371311 1371490 + NC_020520.1 Ilumatobacter coccineus YM16-304
16 770034 770252 + NZ_HG938353.1 Neorhizobium galegae bv. orientalis str. HAMBI 540
17 2205059 2205247 + NZ_CP060789.1 Tessaracoccus defluvii
18 373530 373742 - NZ_CP045929.1 Saccharopolyspora coralli
19 3334386 3334571 + NZ_AP019700.1 Stella humosa
20 3236703 3236888 + NZ_CP032624.1 Gryllotalpicola protaetiae
21 3867691 3867915 - NZ_AP022603.1 Mycolicibacterium fallax
22 1971481 1971651 - NZ_CP048813.1 Rhodococcus triatomae
23 1245544 1245714 - NZ_CP033972.1 Gordonia insulae
24 124928 125143 - NZ_CP007501.1 Polynucleobacter duraquae
25 186866 187102 - NZ_CP042304.1 Devosia ginsengisoli
26 152723 152893 + NC_016907.1 Gordonia polyisoprenivorans VH2
27 609792 610004 + NZ_CP026538.1 Desulfovibrio carbinolicus
28 803742 803942 + NZ_AP022565.1 Mycolicibacterium alvei
29 1236358 1236558 - NZ_AP022563.1 Mycolicibacterium duvalii
30 2200865 2201083 - NC_016147.2 Pseudoxanthomonas spadix BD-a59
31 258175 258387 - NZ_CP054615.1 Azospirillum oryzae
32 1970309 1970509 - NZ_AP022605.1 Mycobacterium doricum
33 4230002 4230208 + NZ_AP022572.1 Mycobacterium shottsii
34 2550748 2550948 + NZ_LR134355.1 Mycolicibacterium chitae
35 4352545 4352745 - NZ_AP022615.1 Mycobacterium heidelbergense
36 3498192 3498392 - NZ_AP022574.1 Mycolicibacterium psychrotolerans
37 285935 286135 - NZ_CP038213.1 Ornithinimicrobium flavum
38 3108111 3108311 - NC_008726.1 Mycolicibacterium vanbaalenii PYR-1
39 1776443 1776643 + NZ_CP014989.1 Serinicoccus hydrothermalis
40 1087476 1087676 + NZ_AP022569.1 Mycobacterium cookii
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NZ_LN831039.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF02452.19 0.79 31 -3 same-strand PemK-like, MazF-like toxin of type II toxin-antitoxin system
++ More..