Result : EXP02016
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02016 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 2459168 |
| Right | 2459293 |
| Strand | - |
| Nucleotide Sequence | GTGGTGCCGTCGCCGTCGGACTCCCGCCAGGGAAAAACGGTCTCCATTCCACCGGCGTCCATATCCTCCGGGCGCATTTTGATGAACGGTGGTCCGTCCTCCGTGCCGGTGGCGCGCGCCAGATAG |
| Sequence | VVPSPSDSRQGKTVSIPPASISSGRILMNGGPSSVPVARAR |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 58
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2511836 | 2511961 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 2459168 | 2459293 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 2345242 | 2345367 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 4 | 187023 | 187148 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 5 | 1230640 | 1230765 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 6 | 2264607 | 2264732 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 7 | 2358131 | 2358256 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 8 | 665997 | 666122 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 9 | 3368264 | 3368389 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 10 | 2249854 | 2249976 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 11 | 121057 | 121182 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 12 | 2127011 | 2127136 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 13 | 5257959 | 5258084 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 14 | 4620150 | 4620275 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 15 | 4110807 | 4110932 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 16 | 1212490 | 1212615 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 17 | 4895797 | 4895922 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 18 | 3403848 | 3403988 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 19 | 3587984 | 3588109 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 20 | 1243313 | 1243453 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 21 | 3721448 | 3721570 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 22 | 1304577 | 1304720 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 23 | 4509567 | 4509692 | - | NZ_AP022572.1 | Mycobacterium shottsii |
| 24 | 970699 | 970842 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 25 | 2583902 | 2584027 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 26 | 1021734 | 1021859 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 27 | 7393194 | 7393319 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 28 | 1879555 | 1879680 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 29 | 3786721 | 3786846 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 30 | 309521 | 309646 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 31 | 4497796 | 4497921 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 32 | 1905185 | 1905310 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 33 | 4010859 | 4010984 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 34 | 4347275 | 4347400 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 35 | 3845447 | 3845569 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 36 | 2798197 | 2798322 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 37 | 3264625 | 3264750 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 38 | 3175072 | 3175197 | + | NZ_AP022574.1 | Mycolicibacterium psychrotolerans |
| 39 | 1970098 | 1970223 | + | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
| 40 | 3567771 | 3567896 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 41 | 4630002 | 4630127 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 42 | 3633572 | 3633700 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 43 | 1969358 | 1969483 | + | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 44 | 1795338 | 1795463 | - | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 45 | 2035458 | 2035580 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 46 | 1915746 | 1915868 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 47 | 1041608 | 1041736 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 48 | 1326102 | 1326221 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 49 | 3510625 | 3510750 | + | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 50 | 6219182 | 6219307 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 51 | 1972794 | 1972916 | + | NZ_CP014955.1 | Mycobacteroides abscessus |
| 52 | 1620602 | 1620715 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 53 | 1244538 | 1244660 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 54 | 2117934 | 2118056 | + | NZ_CP011530.1 | Mycobacteroides immunogenum |
| 55 | 1767859 | 1767981 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 56 | 2702939 | 2703043 | + | NZ_CP027114.1 | Gordonia alkanivorans |
| 57 | 4083297 | 4083428 | + | NZ_CP015235.1 | Rhodococcus fascians D188 |
| 58 | 383509 | 383628 | - | NZ_CP040676.1 | Exiguobacterium mexicanum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00929.26 | 0.9 | 52 | 3281.5 | opposite-strand | Exonuclease |
| 2 | PF16473.7 | 0.64 | 37 | 3306 | opposite-strand | 3' exoribonuclease, RNase T-like |
| 3 | PF00591.23 | 0.98 | 57 | 2346 | same-strand | Glycosyl transferase family, a/b domain |
| 4 | PF02885.19 | 0.6 | 35 | 2325 | same-strand | Glycosyl transferase family, helical bundle domain |
| 5 | PF13442.8 | 0.98 | 57 | 668 | opposite-strand | Cytochrome C oxidase, cbb3-type, subunit III |
| 6 | PF00034.23 | 0.76 | 44 | 674.0 | opposite-strand | Cytochrome c |
| 7 | PF19297.1 | 0.98 | 57 | -125 | opposite-strand | QcrA subunit N-terminal region |
| 8 | PF13631.8 | 0.98 | 57 | 385 | opposite-strand | Cytochrome b(N-terminal)/b6/petB |
| 9 | PF00033.21 | 0.98 | 57 | 385 | opposite-strand | Cytochrome b/b6/petB |
| 10 | PF14358.8 | 0.74 | 43 | 385 | opposite-strand | Domain of unknown function (DUF4405) |
| 11 | PF10812.10 | 0.93 | 54 | 2510.0 | same-strand | Protein of unknown function (DUF2561) |
| 12 | PF12270.10 | 0.6 | 35 | 4080 | same-strand | Cytochrome c oxidase subunit IV |
++ More..