Result : EXP02011
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02011 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 2157984 |
| Right | 2158082 |
| Strand | - |
| Nucleotide Sequence | ATGGGTGGCCCGGGGCCCGGCTGTCTGGTAAGCGCGGCCGCAAAACAGCTGTACTCTCGAATCCCAGTTAGTAACAATGTGCTATGGAATCTCCAATGA |
| Sequence | MGGPGPGCLVSAAAKQLYSRIPVSNNVLWNLQ |
| Source of smORF | Transcriptional-level |
| Function | It is a short ORF coupled to a downstream gene whose start codon overlaps the stop codon of this ORF. This indicates that this smORF might be translationally coupled to downstream gene. Pubmed:26536359 |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Manually curated function from literature |
| Uniprot ID | |
| ORF Length (Amino Acid) | 32 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2157984 | 2158082 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 2196737 | 2196835 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF14081.8 | 1.0 | 2 | 4255.0 | same-strand | Domain of unknown function (DUF4262) |
| 2 | PF00141.25 | 1.0 | 2 | 1873.0 | same-strand | Peroxidase |
| 3 | PF01475.21 | 1.0 | 2 | 1387.5 | same-strand | Ferric uptake regulator family |
| 4 | PF01161.22 | 1.0 | 2 | 330.5 | same-strand | Phosphatidylethanolamine-binding protein |
| 5 | PF00107.28 | 1.0 | 2 | 5.0 | same-strand | Zinc-binding dehydrogenase |
| 6 | PF13602.8 | 1.0 | 2 | 5.0 | same-strand | Zinc-binding dehydrogenase |
++ More..