Result : EXP02005
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP02005 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 1711048 |
| Right | 1711155 |
| Strand | - |
| Nucleotide Sequence | GTGGCGTCCGTGGAGGCATCGTCAGCGATGATCACCTCGACGGGGAACTCGGTCCTCTGGGCGGCGAAGCCGTCCAGGGCCTCGCGAATGTACTCCTCTTGGTTGTAG |
| Sequence | VASVEASSAMITSTGNSVLWAAKPSRASRMYSSWL |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 35 |
++ More..
| Conservation Analysis |
No. of Species: 8
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1735226 | 1735333 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 1711048 | 1711155 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 718344 | 718436 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 4 | 3089442 | 3089534 | - | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 5 | 219322 | 219414 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 6 | 305186 | 305278 | + | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 7 | 693575 | 693682 | - | NZ_CP042433.1 | Flavisolibacter ginsenosidimutans |
| 8 | 6851155 | 6851259 | - | NZ_CP045293.1 | Paenibacillus guangzhouensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00535.28 | 0.88 | 7 | 445 | opposite-strand | Glycosyl transferase family 2 |
++ More..