Result : EXP02002

Protein Information

• Protein name: EXP02002
• NCBI Accession ID: NC_000962.3
• Organism: Mycobacterium tuberculosis H37Rv
• Left: 169207
• Right: 169305
• Strand: -
• Nucleotide Sequence: ATGCCCGAGTCTTTCACGCGTCGGTGGCAATTACGCGCCGGCTGCCCGGGGGCCCGGTGCTCAAACCGGCGATCGGCGGACTGCTGGTCGGGCTGTTAG
• Sequence: MPESFTRRWQLRAGCPGARCSNRRSADCWSGC
• Source of smORF: Transcriptional-level
• Pubmed ID: 26536359
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 32

Conservation Analysis

No. of Species: 4

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	173005	173103	-	NC_015848.1	Mycobacterium canettii CIPT 140010059
2	169207	169305	-	NC_000962.3	Mycobacterium tuberculosis H37Rv
3	313422	313529	-	NZ_AP018164.1	Mycobacterium shigaense
4	2879524	2879610	-	NZ_CP034412.1	Glutamicibacter creatinolyticus

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_015848.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF04248.14	0.75	3	1917	opposite-strand	Domain of unknown function (DUF427)
2	PF12680.9	0.75	3	1526	same-strand	SnoaL-like domain
3	PF00654.22	0.75	3	-98	same-strand	Voltage gated chloride channel
4	PF00440.25	0.75	3	984	opposite-strand	Bacterial regulatory proteins, tetR family
5	PF04072.16	0.75	3	2766.5	opposite-strand	Leucine carboxyl methyltransferase