Result : EXP01999
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01999 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 1634821 |
| Right | 1634961 |
| Strand | - |
| Nucleotide Sequence | GTGGCAGCAGAGCCGCAGGGTCGATTCACACGACTTCGCCGGCATATCGGCACCGCTCGCCAGCCCGAACCGCGGTCAGGACAATTTTCACACCAGCCCGATGAAAATCGCTATCTGGGATTGATCAGTGTGACGCCCTAA |
| Sequence | VAAEPQGRFTRLRRHIGTARQPEPRSGQFSHQPDENRYLGLISVTP |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 46 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1658127 | 1658267 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 1634821 | 1634961 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF10128.11 | 1.0 | 2 | 9574.5 | same-strand | Glucose-6-phosphate dehydrogenase subunit |
| 2 | PF02781.18 | 1.0 | 2 | 7977.5 | same-strand | Glucose-6-phosphate dehydrogenase, C-terminal domain |
| 3 | PF00479.24 | 1.0 | 2 | 7977.5 | same-strand | Glucose-6-phosphate dehydrogenase, NAD binding domain |
| 4 | PF00923.21 | 1.0 | 2 | 6859.5 | same-strand | Transaldolase/Fructose-6-phosphate aldolase |
| 5 | PF00456.23 | 1.0 | 2 | 4740.5 | same-strand | Transketolase, thiamine diphosphate binding domain |
| 6 | PF02779.26 | 1.0 | 2 | 4740.5 | same-strand | Transketolase, pyrimidine binding domain |
| 7 | PF02780.22 | 1.0 | 2 | 4740.5 | same-strand | Transketolase, C-terminal domain |
| 8 | PF00934.22 | 1.0 | 2 | 618.5 | same-strand | PE family |
| 9 | PF01040.20 | 1.0 | 2 | 68.0 | opposite-strand | UbiA prenyltransferase family |
| 10 | PF17853.3 | 1.0 | 2 | 3784.0 | opposite-strand | GGDEF-like domain |
| 11 | PF13556.8 | 1.0 | 2 | 3784.0 | opposite-strand | PucR C-terminal helix-turn-helix domain |
| 12 | PF00107.28 | 1.0 | 2 | 5110.0 | same-strand | Zinc-binding dehydrogenase |
| 13 | PF13602.8 | 1.0 | 2 | 5110.0 | same-strand | Zinc-binding dehydrogenase |
++ More..