Result : EXP01997
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01997 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 1608956 |
| Right | 1609081 |
| Strand | - |
| Nucleotide Sequence | GTGAAAGAGCACCATGAACCCGATGAGGAACCACCGCCATGGGTGACCGTCGGCGACGAGCACCAGAATCCCGGGCACCAGGAATTCCGCCGTGGTGCCACCCCCGTGGGCCATGAGTTTCGGTAG |
| Sequence | VKEHHEPDEEPPPWVTVGDEHQNPGHQEFRRGATPVGHEFR |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 41 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1632206 | 1632331 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 1608956 | 1609081 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 2197516 | 2197641 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 4 | 1860163 | 1860288 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 5 | 6122573 | 6122713 | + | NZ_AP022576.1 | Mycobacterium florentinum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00501.30 | 0.8 | 4 | 4410.5 | same-strand | AMP-binding enzyme |
| 2 | PF13193.8 | 0.8 | 4 | 4410.5 | same-strand | AMP-binding enzyme C-terminal domain |
| 3 | PF01553.23 | 0.6 | 3 | 4197 | same-strand | Acyltransferase |
| 4 | PF00934.22 | 0.6 | 3 | 984 | opposite-strand | PE family |
| 5 | PF12077.10 | 1.0 | 5 | -125 | opposite-strand | Transmembrane protein of unknown function (DUF3556) |
| 6 | PF03734.16 | 0.6 | 3 | 2353 | opposite-strand | L,D-transpeptidase catalytic domain |
| 7 | PF02800.22 | 0.8 | 4 | 3919.0 | opposite-strand | Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain |
| 8 | PF00044.26 | 0.8 | 4 | 3919.0 | opposite-strand | Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain |
| 9 | PF00162.21 | 0.6 | 3 | 4634 | opposite-strand | Phosphoglycerate kinase |
++ More..