Result : EXP01996
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01996 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 1494361 |
| Right | 1494480 |
| Strand | - |
| Nucleotide Sequence | GTGGGTATCGGGCGCAAGAAGGACACACAAGGAACGACACATACAAGATGTCCCGGTGAGTGGCCGGGCAATCGGAACGGAAACGGAGTGGTGGGTGCCCGGTCGTGTCGAAATCGATGA |
| Sequence | VGIGRKKDTQGTTHTRCPGEWPGNRNGNGVVGARSCRNR |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 39 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1494361 | 1494480 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1519060 | 1519179 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00108.25 | 1.0 | 2 | 7334.5 | opposite-strand | Thiolase, N-terminal domain |
| 2 | PF02803.20 | 1.0 | 2 | 7334.5 | opposite-strand | Thiolase, C-terminal domain |
| 3 | PF14561.8 | 1.0 | 2 | 6290.5 | opposite-strand | Tetratricopeptide repeat |
| 4 | PF00085.22 | 1.0 | 2 | 6290.5 | opposite-strand | Thioredoxin |
| 5 | PF00934.22 | 1.0 | 2 | 4396.0 | same-strand | PE family |
| 6 | PF02922.20 | 1.0 | 2 | 2049.0 | same-strand | Carbohydrate-binding module 48 (Isoamylase N-terminal domain) |
| 7 | PF02806.20 | 1.0 | 2 | 2049.0 | same-strand | Alpha amylase, C-terminal all-beta domain |
| 8 | PF11896.10 | 1.0 | 2 | -25.0 | same-strand | Domain of unknown function (DUF3416) |
| 9 | PF11897.10 | 1.0 | 2 | 84.0 | opposite-strand | Protein of unknown function (DUF3417) |
| 10 | PF13307.8 | 1.0 | 2 | 2715.0 | same-strand | Helicase C-terminal domain |
| 11 | PF17767.3 | 1.0 | 2 | 4733.0 | same-strand | Nicotinate phosphoribosyltransferase (NAPRTase) N-terminal domain |
| 12 | PF01729.21 | 1.0 | 2 | 4733.0 | same-strand | Quinolinate phosphoribosyl transferase, C-terminal domain |
| 13 | PF02617.19 | 1.0 | 2 | 6181.0 | opposite-strand | ATP-dependent Clp protease adaptor protein ClpS |
| 14 | PF09438.12 | 1.0 | 2 | 6512.0 | opposite-strand | Domain of unknown function (DUF2017) |
++ More..