Result : EXP01988
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01988 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 208328 |
| Right | 208420 |
| Strand | + |
| Nucleotide Sequence | GTGCGGGCGATCTTCCAAAAATCGCGCGGGCAATGGCGCCTCGACGATCTGGCAGTCGTGATGAAACCCCGACAACCCACCGGCGAAAAATGA |
| Sequence | VRAIFQKSRGQWRLDDLAVVMKPRQPTGEK |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 30 |
++ More..
| Conservation Analysis |
No. of Species: 16
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 208328 | 208420 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 215053 | 215145 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 131320 | 131412 | + | NC_015576.1 | Mycolicibacter sinensis |
| 4 | 1826527 | 1826619 | - | NZ_AP022562.1 | Mycobacterium novum |
| 5 | 368786 | 368872 | + | NZ_AP018164.1 | Mycobacterium shigaense |
| 6 | 1993131 | 1993217 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 7 | 7377672 | 7377764 | - | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 8 | 4072110 | 4072205 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 9 | 120432 | 120524 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 10 | 2268392 | 2268487 | - | NZ_AP022568.1 | Mycobacterium simiae |
| 11 | 2226035 | 2226127 | - | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 12 | 3619650 | 3619745 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 13 | 2032809 | 2032898 | + | NZ_AP022583.1 | Mycobacterium noviomagense |
| 14 | 5004766 | 5004861 | - | NZ_CP023147.1 | Mycobacterium marseillense |
| 15 | 3897155 | 3897244 | - | NZ_AP022614.1 | Mycobacterium parmense |
| 16 | 493649 | 493738 | + | NZ_CP025546.1 | Mycobacterium paragordonae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015576.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02470.22 | 1.0 | 16 | 3713.0 | same-strand | MlaD protein |
| 2 | PF06912.13 | 0.81 | 13 | 1273 | same-strand | Protein of unknown function (DUF1275) |
++ More..