ProsmORF-pred
Result : B3EGN5
Protein Information
Information Type Description
Protein name 30S ribosomal protein S21
NCBI Accession ID CP001097.1
Organism Chlorobium limicola (strain DSM 245 / NBRC 103803 / 6330)
Left 2344537
Right 2344734
Strand -
Nucleotide Sequence TTGGTTAGTGTGCAGATTAATGATAACGAGTCCATCGACAAGATGCTGAAGCGCTTCAAAAAGAAATATGAGAGAGCTGGCGTGTTGAAGGAGTTCCGAAAGAGAGCATACTTTGTCAAACCGTCAGTGGACAGCCGTCTGAAACGTTCGAGATGCAAGCGAAGAGCTCAGAGAGCGAATGAAGAGAGCAATTCCTGA
Sequence MVSVQINDNESIDKMLKRFKKKYERAGVLKEFRKRAYFVKPSVDSRLKRSRCKRRAQRANEESNS
Source of smORF Swiss-Prot
Function The ORF matches to the profile of cl00529. Profile Description: Ribosomal protein S21. 30S ribosomal protein S21; Reviewed
Pubmed ID
Domain CDD:412427
Functional Category Ribosomal_protein
Uniprot ID B3EGN5
ORF Length (Amino Acid) 65
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 33
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 2344537 2344734 - NC_010803.1 Chlorobium limicola DSM 245
2 2304184 2304381 - NZ_CP017305.1 Chlorobaculum limnaeum
3 308300 308497 + NC_011027.1 Chlorobaculum parvum NCIB 8327
4 2125221 2125418 - NC_011059.1 Prosthecochloris aestuarii DSM 271
5 1588585 1588782 - NC_011026.1 Chloroherpeton thalassium ATCC 35110
6 2611425 2611622 - NC_008639.1 Chlorobium phaeobacteroides DSM 266
7 288961 289158 + NC_007512.1 Pelodictyon luteolum DSM 273
8 2619202 2619399 - NC_011060.1 Pelodictyon phaeoclathratiforme BU-1
9 1814914 1815111 - NC_002932.3 Chlorobaculum tepidum TLS
10 2610727 2610918 + NC_017464.1 Ignavibacterium album JCM 16511
11 499073 499276 + NC_018178.1 Melioribacter roseus P3M-2
12 4426113 4426307 - NZ_CP021235.1 Pontibacter actiniarum
13 597069 597263 - NZ_CP037922.1 Hymenobacter radiodurans
14 3211530 3211724 - NZ_CP047984.1 Pontibacter russatus
15 3566286 3566480 - NZ_CP047897.1 Nibribacter ruber
16 3683884 3684075 - NZ_CP032317.1 Hymenobacter oligotrophus
17 1905471 1905665 - NZ_CP009621.1 Pontibacter korlensis
18 2871962 2872156 + NZ_CP048106.1 Pontibacter pudoricolor
19 198479 198673 - NZ_CP010777.1 Rufibacter radiotolerans
20 2448248 2448442 - NZ_CP014766.1 Pontibacter akesuensis
21 4366034 4366231 + NC_018018.1 Bernardetia litoralis DSM 6794
22 2436354 2436548 - NZ_CP055156.1 Adhaeribacter swui
23 2790243 2790437 - NZ_CP012643.1 Rufibacter tibetensis
24 6684485 6684679 - NZ_CP055153.1 Adhaeribacter radiodurans
25 1857235 1857432 + NZ_CP032382.1 Chryseolinea soli
26 68093 68287 + NZ_CP034930.1 Apibacter raozihei
27 1121818 1122009 - NC_009614.1 Phocaeicola vulgatus ATCC 8482
28 1124478 1124669 - NZ_LR699004.1 Phocaeicola dorei
29 410223 410414 + NC_014370.1 Prevotella melaninogenica ATCC 25845
30 388829 389020 + NZ_CP023863.1 Prevotella jejuni
31 103770 103961 - NZ_CP024727.1 Prevotella intermedia
32 341324 341503 + NZ_CP009761.1 Parvimonas micra
33 1708402 1708584 - NC_008593.1 Clostridium novyi NT
++ More..