Result : EXP01970
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01970 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 405143 |
| Right | 405265 |
| Strand | + |
| Nucleotide Sequence | GTGCTTGGAATGCAAAACGAGGATCAGGAACGCAAGCATGACCCCGATGTGCAGCAACAGCGCTGTGGTTTCGATGATTTCGTTGGCGGGCTGCCCGAGGGGGCGAAGAATCGCGCCGAATAG |
| Sequence | VLGMQNEDQERKHDPDVQQQRCGFDDFVGGLPEGAKNRAE |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 412920 | 413042 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 405143 | 405265 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 3 | 1588236 | 1588364 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 4 | 4084901 | 4085008 | - | NZ_AP022581.1 | Mycobacterium lacus |
| 5 | 3795919 | 3796050 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 6 | 3002832 | 3002936 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
| 7 | 1827324 | 1827422 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00155.23 | 1.0 | 7 | 2275 | opposite-strand | Aminotransferase class I and II |
| 2 | PF02754.18 | 1.0 | 7 | -122 | opposite-strand | Cysteine-rich domain |
| 3 | PF13183.8 | 1.0 | 7 | -122 | opposite-strand | 4Fe-4S dicluster domain |
| 4 | PF13187.8 | 1.0 | 7 | -122 | opposite-strand | 4Fe-4S dicluster domain |
| 5 | PF13237.8 | 1.0 | 7 | -122 | opposite-strand | 4Fe-4S dicluster domain |
| 6 | PF00196.21 | 1.0 | 7 | 702 | opposite-strand | Bacterial regulatory proteins, luxR family |
| 7 | PF08281.14 | 1.0 | 7 | 702 | opposite-strand | Sigma-70, region 4 |
++ More..