Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01970 |
NCBI Accession ID | NC_000962.3 |
Organism | Mycobacterium tuberculosis H37Rv |
Left | 405143 |
Right | 405265 |
Strand | + |
Nucleotide Sequence | GTGCTTGGAATGCAAAACGAGGATCAGGAACGCAAGCATGACCCCGATGTGCAGCAACAGCGCTGTGGTTTCGATGATTTCGTTGGCGGGCTGCCCGAGGGGGCGAAGAATCGCGCCGAATAG |
Sequence | VLGMQNEDQERKHDPDVQQQRCGFDDFVGGLPEGAKNRAE |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | 26536359 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 40 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 412920 | 413042 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
2 | 405143 | 405265 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
3 | 1588236 | 1588364 | - | NZ_AP022615.1 | Mycobacterium heidelbergense |
4 | 4084901 | 4085008 | - | NZ_AP022581.1 | Mycobacterium lacus |
5 | 3795919 | 3796050 | + | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
6 | 3002832 | 3002936 | - | NZ_AP022593.1 | Mycolicibacterium arabiense |
7 | 1827324 | 1827422 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00155.23 | 1.0 | 7 | 2275 | opposite-strand | Aminotransferase class I and II |
2 | PF02754.18 | 1.0 | 7 | -122 | opposite-strand | Cysteine-rich domain |
3 | PF13183.8 | 1.0 | 7 | -122 | opposite-strand | 4Fe-4S dicluster domain |
4 | PF13187.8 | 1.0 | 7 | -122 | opposite-strand | 4Fe-4S dicluster domain |
5 | PF13237.8 | 1.0 | 7 | -122 | opposite-strand | 4Fe-4S dicluster domain |
6 | PF00196.21 | 1.0 | 7 | 702 | opposite-strand | Bacterial regulatory proteins, luxR family |
7 | PF08281.14 | 1.0 | 7 | 702 | opposite-strand | Sigma-70, region 4 |