Result : EXP01966
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01966 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 3893958 |
| Right | 3894080 |
| Strand | + |
| Nucleotide Sequence | GTGTTGGGGTCGATTTGGCCGGACCAGTCGTCACCAACGCTTGGCGTGCGCGCCAGGCGGGCGATCAGATCGCTTGACTACCAATCAATCTTGAGCTCCCGGGCCGATGCTCGGGCTAAATGA |
| Sequence | VLGSIWPDQSSPTLGVRARRAIRSLDYQSILSSRADARAK |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3951863 | 3951985 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 3893958 | 3894080 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13577.8 | 1.0 | 2 | 3411.0 | same-strand | SnoaL-like domain |
| 2 | PF14534.8 | 1.0 | 2 | 3411.0 | same-strand | Domain of unknown function (DUF4440) |
| 3 | PF12680.9 | 1.0 | 2 | 3411.0 | same-strand | SnoaL-like domain |
| 4 | PF12697.9 | 1.0 | 2 | 2487.5 | opposite-strand | Alpha/beta hydrolase family |
| 5 | PF12146.10 | 1.0 | 2 | 2487.5 | opposite-strand | Serine aminopeptidase, S33 |
| 6 | PF07690.18 | 1.0 | 2 | 238.0 | opposite-strand | Major Facilitator Superfamily |
| 7 | PF00934.22 | 1.0 | 2 | 13.0 | same-strand | PE family |
| 8 | PF00823.21 | 1.0 | 2 | 346.0 | same-strand | PPE family |
| 9 | PF12484.10 | 1.0 | 2 | 346.0 | same-strand | PPE-SVP subfamily C-terminal region |
| 10 | PF01734.24 | 1.0 | 2 | 1602.0 | same-strand | Patatin-like phospholipase |
| 11 | PF03007.18 | 1.0 | 2 | 4829.0 | opposite-strand | Wax ester synthase-like Acyl-CoA acyltransferase domain |
| 12 | PF06974.15 | 1.0 | 2 | 4829.0 | opposite-strand | WS/DGAT C-terminal domain |
| 13 | PF11139.10 | 1.0 | 2 | 6413.0 | opposite-strand | Sap, sulfolipid-1-addressing protein |
++ More..