Protein Information |
Information Type | Description |
---|---|
Protein name | EXP01963 |
NCBI Accession ID | NC_000962.3 |
Organism | Mycobacterium tuberculosis H37Rv |
Left | 3765565 |
Right | 3765669 |
Strand | + |
Nucleotide Sequence | GTGATGGTCAGCGGGCCGATGTTGATGGGTATGCCGATACCGCCGCCGAAGGCGGGGATCACGATGTCGGGAACCACCAGCGGGCCCAAGTTGACGGTTTGGTGA |
Sequence | VMVSGPMLMGMPIPPPKAGITMSGTTSGPKLTVW |
Source of smORF | Transcriptional-level |
Function | |
Pubmed ID | 26536359 |
Domain | |
Functional Category | Function not yet assigned |
Uniprot ID | |
ORF Length (Amino Acid) | 34 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2866919 | 2867023 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
2 | 2838965 | 2839066 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
3 | 3765565 | 3765669 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
4 | 3751653 | 3751754 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
5 | 3835285 | 3835389 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
6 | 3821369 | 3821467 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF01469.20 | 1.0 | 3 | 4197.0 | opposite-strand | Pentapeptide repeats (8 copies) |
2 | PF00823.21 | 1.0 | 3 | 4197.0 | opposite-strand | PPE family |
3 | PF00934.22 | 1.0 | 3 | 10464.5 | opposite-strand | PE family |
4 | PF01548.19 | 0.67 | 2 | 6660.0 | same-strand | Transposase |
5 | PF05305.16 | 0.67 | 2 | 3437.5 | same-strand | Protein of unknown function (DUF732) |
6 | PF11222.10 | 0.67 | 2 | 8198 | opposite-strand | Protein of unknown function (DUF3017) |