Result : EXP01963

Protein Information

• Protein name: EXP01963
• NCBI Accession ID: NC_000962.3
• Organism: Mycobacterium tuberculosis H37Rv
• Left: 3765565
• Right: 3765669
• Strand: +
• Nucleotide Sequence: GTGATGGTCAGCGGGCCGATGTTGATGGGTATGCCGATACCGCCGCCGAAGGCGGGGATCACGATGTCGGGAACCACCAGCGGGCCCAAGTTGACGGTTTGGTGA
• Sequence: VMVSGPMLMGMPIPPPKAGITMSGTTSGPKLTVW
• Source of smORF: Transcriptional-level
• Pubmed ID: 26536359
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 34

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2866919	2867023	+	NZ_AP022575.1	Mycobacterium shinjukuense
2	2838965	2839066	+	NZ_AP022575.1	Mycobacterium shinjukuense
3	3765565	3765669	+	NC_000962.3	Mycobacterium tuberculosis H37Rv
4	3751653	3751754	+	NC_000962.3	Mycobacterium tuberculosis H37Rv
5	3835285	3835389	+	NC_015848.1	Mycobacterium canettii CIPT 140010059
6	3821369	3821467	+	NC_015848.1	Mycobacterium canettii CIPT 140010059

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000962.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF01469.20	1.0	3	4197.0	opposite-strand	Pentapeptide repeats (8 copies)
2	PF00823.21	1.0	3	4197.0	opposite-strand	PPE family
3	PF00934.22	1.0	3	10464.5	opposite-strand	PE family
4	PF01548.19	0.67	2	6660.0	same-strand	Transposase
5	PF05305.16	0.67	2	3437.5	same-strand	Protein of unknown function (DUF732)
6	PF11222.10	0.67	2	8198	opposite-strand	Protein of unknown function (DUF3017)