Result : EXP01962
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01962 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 3717118 |
| Right | 3717222 |
| Strand | + |
| Nucleotide Sequence | ATGACTACAGCCCTATACCAGGACGCGGGGTTCACGCCCGCCGGGGCGCCCGACGACCCCGACCGCGTGGTGGACGTGCTGAGCGCCCCGGTACCGGTCAACTGA |
| Sequence | MTTALYQDAGFTPAGAPDDPDRVVDVLSAPVPVN |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 34 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3784817 | 3784921 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 3717118 | 3717222 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04542.16 | 1.0 | 2 | 2777.0 | opposite-strand | Sigma-70 region 2 |
| 2 | PF08281.14 | 1.0 | 2 | 2777.0 | opposite-strand | Sigma-70, region 4 |
| 3 | PF12680.9 | 1.0 | 2 | 2777.0 | opposite-strand | SnoaL-like domain |
| 4 | PF04545.18 | 1.0 | 2 | 2777.0 | opposite-strand | Sigma-70, region 4 |
| 5 | PF00202.23 | 1.0 | 2 | 1410.0 | same-strand | Aminotransferase class-III |
| 6 | PF00768.22 | 1.0 | 2 | 124.0 | same-strand | D-alanyl-D-alanine carboxypeptidase |
| 7 | PF00083.26 | 1.0 | 2 | -104.0 | same-strand | Sugar (and other) transporter |
| 8 | PF07690.18 | 1.0 | 2 | -104.0 | same-strand | Major Facilitator Superfamily |
| 9 | PF01979.22 | 1.0 | 2 | 1373.0 | same-strand | Amidohydrolase family |
| 10 | PF05305.16 | 1.0 | 2 | 2715.0 | opposite-strand | Protein of unknown function (DUF732) |
| 11 | PF09278.13 | 1.0 | 2 | 4035.0 | same-strand | MerR, DNA binding |
| 12 | PF13411.8 | 1.0 | 2 | 4035.0 | same-strand | MerR HTH family regulatory protein |
| 13 | PF00376.25 | 1.0 | 2 | 4035.0 | same-strand | MerR family regulatory protein |
| 14 | PF03631.17 | 1.0 | 2 | 4509.0 | opposite-strand | Virulence factor BrkB |
++ More..