Result : B3EBH2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Flagellar hook-basal body complex protein FliE |
| NCBI Accession ID | CP001089.1 |
| Organism | Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) |
| Left | 3536454 |
| Right | 3536753 |
| Strand | - |
| Nucleotide Sequence | ATGGAAATTAACGGTATCAGTGGTGTCGGCATGTCTACAGCCTTTCCGCTTGAAAAAAATACATCCTCCACGTCGGTGGCAGATGGGGCTGGTAAATTCTTCAAAGAGCTGGTGGGCAAGGTAAACGATTTGTCACAACAGTCTGACCAGGCAATTCAGAAACTTGCAACCGGAGAAAATCGTAACCTGCACGAAACCATGATTGCAGTAGAGAAGGCCAGCGTGTCGTTTCTGTTTATGTCGCAGGTGCGCAACAAGGCGCTGGAGGCGTATCAGGAAGTGATGAGGATGCCGGTCTAG |
| Sequence | MEINGISGVGMSTAFPLEKNTSSTSVADGAGKFFKELVGKVNDLSQQSDQAIQKLATGENRNLHETMIAVEKASVSFLFMSQVRNKALEAYQEVMRMPV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09139. Profile Description: Flagellar hook-basal body complex protein FliE. fliE is a component of the flagellar hook-basal body complex located possibly at (MS-ring)-rod junction. [Cellular processes, Chemotaxis and motility] |
| Pubmed ID | |
| Domain | CDD:415593 |
| Functional Category | Others |
| Uniprot ID | B3EBH2 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 9
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3536454 | 3536753 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 2 | 3787678 | 3787980 | + | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 3 | 4874635 | 4874943 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 4 | 3512284 | 3512589 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 5 | 569063 | 569314 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 6 | 440458 | 440760 | + | NC_002939.5 | Geobacter sulfurreducens PCA |
| 7 | 4378365 | 4378679 | - | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 8 | 4254128 | 4254430 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 9 | 3134110 | 3134412 | - | NZ_CP009788.1 | Geobacter pickeringii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010814.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02050.18 | 1.0 | 9 | 4805 | same-strand | Flagellar FliJ protein |
| 2 | PF00006.27 | 1.0 | 9 | 3431 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 3 | PF18269.3 | 1.0 | 9 | 3431 | same-strand | T3SS EscN ATPase C-terminal domain |
| 4 | PF02108.18 | 1.0 | 9 | 2652 | same-strand | Flagellar assembly protein FliH |
| 5 | PF01706.18 | 1.0 | 9 | 1676 | same-strand | FliG C-terminal domain |
| 6 | PF14842.8 | 1.0 | 9 | 1676 | same-strand | FliG N-terminal domain |
| 7 | PF14841.8 | 1.0 | 9 | 1676 | same-strand | FliG middle domain |
| 8 | PF01514.19 | 1.0 | 9 | 72 | same-strand | Secretory protein of YscJ/FliF family |
| 9 | PF08345.13 | 1.0 | 9 | 72 | same-strand | Flagellar M-ring protein C-terminal |
| 10 | PF00460.22 | 1.0 | 9 | 59 | same-strand | Flagella basal body rod protein |
| 11 | PF13432.8 | 0.78 | 7 | 1064 | same-strand | Tetratricopeptide repeat |
| 12 | PF00072.26 | 0.67 | 6 | 3445.0 | same-strand | Response regulator receiver domain |
| 13 | PF13690.8 | 1.0 | 9 | 4484 | same-strand | Chemotaxis phosphatase CheX |
++ More..