Result : EXP01961
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01961 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 3709582 |
| Right | 3709704 |
| Strand | + |
| Nucleotide Sequence | GTGGCGGATAGTCGATTTGCAATTGGTCGACTAAGCCGTCGACGGTGGTGCCGCTTTCGAGTGAGATCTTCTCGTGAGCGACCTTGCACGCTTCGCGAACCGCGCCAAAGTAGAGCACATTGA |
| Sequence | VADSRFAIGRLSRRRWCRFRVRSSRERPCTLREPRQSRAH |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 40 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3709582 | 3709704 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 2 | 1662687 | 1662815 | + | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_000962.3
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13237.8 | 1.0 | 2 | 2272.5 | both-strands | 4Fe-4S dicluster domain |
++ More..