Result : EXP01956

Protein Information

• Protein name: EXP01956
• NCBI Accession ID: NC_000962.3
• Organism: Mycobacterium tuberculosis H37Rv
• Left: 3196325
• Right: 3196429
• Strand: +
• Nucleotide Sequence: GTGGCTATGGTTCCCGCTCAAACGACCGGCGGCACTGCCCACAAGCGCCGGGAGCGCATAGGAACGATTTACCGTTCGGCCCGGCACATGTGTCAGTATCCTTGA
• Sequence: VAMVPAQTTGGTAHKRRERIGTIYRSARHMCQYP
• Source of smORF: Transcriptional-level
• Pubmed ID: 26536359
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 34

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	3196325	3196429	+	NC_000962.3	Mycobacterium tuberculosis H37Rv
2	3255233	3255337	+	NC_015848.1	Mycobacterium canettii CIPT 140010059

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000962.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00696.30	1.0	2	3167.5	opposite-strand	Amino acid kinase family
2	PF00486.30	1.0	2	2174.5	same-strand	Transcriptional regulatory protein, C terminal
3	PF01385.21	1.0	2	780.0	opposite-strand	Probable transposase
4	PF07282.13	1.0	2	780.0	opposite-strand	Putative transposase DNA-binding domain
5	PF00239.23	1.0	2	193.0	opposite-strand	Resolvase, N terminal domain
6	PF01047.24	1.0	2	2.0	same-strand	MarR family
7	PF12802.9	1.0	2	2.0	same-strand	MarR family
8	PF01425.23	1.0	2	435.0	opposite-strand	Amidase
9	PF00889.21	1.0	2	1863.0	opposite-strand	Elongation factor TS
10	PF00318.22	1.0	2	2690.0	opposite-strand	Ribosomal protein S2