Result : EXP01955
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01955 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 3095128 |
| Right | 3095277 |
| Strand | + |
| Nucleotide Sequence | ATGCCGCAGCATGTTCGATGCCGCGGTGAAGAGCTACCAGTCCGGAGACCTGGCCAATGCCCGAGCGGCCTTTGGCCGCCTCACAGTCGAAAACCCGGACATGTCCGATGGCTGGTTGGGGCTTCTGGCCTGCGGCGACCATCATCTTGA |
| Sequence | MPQHVRCRGEELPVRRPGQCPSGLWPPHSRKPGHVRWLVGASGLRRPSS |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 49 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3155855 | 3156004 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 3095128 | 3095277 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00312.24 | 1.0 | 2 | 1380.5 | opposite-strand | Ribosomal protein S15 |
| 2 | PF06574.14 | 1.0 | 2 | 249.0 | opposite-strand | FAD synthetase |
| 3 | PF01687.19 | 1.0 | 2 | 249.0 | opposite-strand | Riboflavin kinase |
| 4 | PF02742.17 | 1.0 | 2 | 1682.0 | same-strand | Iron dependent repressor, metal binding and dimerisation domain |
| 5 | PF01325.21 | 1.0 | 2 | 1682.0 | same-strand | Iron dependent repressor, N-terminal DNA binding domain |
| 6 | PF04023.16 | 1.0 | 2 | 1682.0 | same-strand | FeoA domain |
| 7 | PF00441.26 | 1.0 | 2 | 2429.0 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 8 | PF02770.21 | 1.0 | 2 | 2429.0 | opposite-strand | Acyl-CoA dehydrogenase, middle domain |
| 9 | PF08028.13 | 1.0 | 2 | 2429.0 | opposite-strand | Acyl-CoA dehydrogenase, C-terminal domain |
| 10 | PF02771.18 | 1.0 | 2 | 2429.0 | opposite-strand | Acyl-CoA dehydrogenase, N-terminal domain |
| 11 | PF00108.25 | 1.0 | 2 | 3687.0 | opposite-strand | Thiolase, N-terminal domain |
++ More..