Result : EXP01949

Protein Information

• Protein name: EXP01949
• NCBI Accession ID: NC_000962.3
• Organism: Mycobacterium tuberculosis H37Rv
• Left: 2641033
• Right: 2641164
• Strand: +
• Nucleotide Sequence: GTGTCGATGACGGGCGCCACGGGGTGGTGCACTCCCTTCGAGGGATCGGGCAGACGCGCGCAGCCCGACACGACTACGCGCAAAACATCAGTCATGGTAGCGATCGGGACCTGGGTCTCCTATTGCCTTTGA
• Sequence: VSMTGATGWCTPFEGSGRRAQPDTTTRKTSVMVAIGTWVSYCL
• Source of smORF: Transcriptional-level
• Pubmed ID: 26536359
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 43

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2699646	2699777	+	NC_015848.1	Mycobacterium canettii CIPT 140010059
2	2641033	2641164	+	NC_000962.3	Mycobacterium tuberculosis H37Rv

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_015848.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00823.21	1.0	2	2790.0	opposite-strand	PPE family
2	PF01469.20	1.0	2	2790.0	opposite-strand	Pentapeptide repeats (8 copies)
3	PF03129.22	1.0	2	-94.0	opposite-strand	Anticodon binding domain
4	PF01022.22	1.0	2	82.0	same-strand	Bacterial regulatory protein, arsR family
5	PF12840.9	1.0	2	82.0	same-strand	Helix-turn-helix domain
6	PF01475.21	1.0	2	486.0	same-strand	Ferric uptake regulator family
7	PF01255.21	1.0	2	1414.0	opposite-strand	Putative undecaprenyl diphosphate synthase
8	PF02565.17	1.0	2	2297.0	opposite-strand	Recombination protein O C terminal
9	PF11967.10	1.0	2	2297.0	opposite-strand	Recombination protein O N terminal