Result : EXP01943

Protein Information

• Protein name: EXP01943
• NCBI Accession ID: NC_000962.3
• Organism: Mycobacterium tuberculosis H37Rv
• Left: 2561476
• Right: 2561604
• Strand: +
• Nucleotide Sequence: ATGGTGATGTGGACGGGCGAAAGTTACTGCCACCGGCACGCCGCACTGGCACCCAACAGAGGAGGATCAGGCCCGCCGCACCCAGGGTCTACACGACCGGCGACATCCTGCGTGATCGGAAGGGCATAG
• Sequence: MVMWTGESYCHRHAALAPNRGGSGPPHPGSTRPATSCVIGRA
• Source of smORF: Transcriptional-level
• Pubmed ID: 26536359
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 42

Conservation Analysis

No. of Species: 2

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2615943	2616071	+	NC_015848.1	Mycobacterium canettii CIPT 140010059
2	2561476	2561604	+	NC_000962.3	Mycobacterium tuberculosis H37Rv

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_015848.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF07859.15	1.0	2	4036.0	same-strand	alpha/beta hydrolase fold
2	PF00326.23	1.0	2	4036.0	same-strand	Prolyl oligopeptidase family
3	PF03007.18	1.0	2	2666.0	same-strand	Wax ester synthase-like Acyl-CoA acyltransferase domain
4	PF06974.15	1.0	2	2666.0	same-strand	WS/DGAT C-terminal domain
5	PF01323.22	1.0	2	1907.0	opposite-strand	DSBA-like thioredoxin domain
6	PF00999.23	1.0	2	145.0	same-strand	Sodium/hydrogen exchanger family
7	PF02611.17	1.0	2	5.0	same-strand	CDP-diacylglycerol pyrophosphatase
8	PF00581.22	1.0	2	1570.0	same-strand	Rhodanese-like domain