| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | CP001089.1 |
| Organism | Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) |
| Left | 2330495 |
| Right | 2330728 |
| Strand | - |
| Nucleotide Sequence | ATGGCAGCTGAAAAATTTGAAACATCGCTGAAAAAGTTGGAAGAGGTGGTCCGCAAGCTGGAAGGGGGCTCACTTTCACTGGATGACTCCATCAAGGCCTTTGAAGAAGGGGTCAAGCATGCTGCCTTTTGTGCCAAGAAACTTGATGAAGCCGAGCGCAAGGTTGAGGTGCTGATCAAGCAGCGCGATGGATCATTCCGCAAAGAGCCGTTTACTACTGATAACGATGACTAA |
| Sequence | MAAEKFETSLKKLEEVVRKLEGGSLSLDDSIKAFEEGVKHAAFCAKKLDEAERKVEVLIKQRDGSFRKEPFTTDNDD |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000255|HAMAP-Rule:MF_00337}. |
| Pubmed ID | |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | B3E479 |
| ORF Length (Amino Acid) | 77 |
| Conservation Analysis |
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2330495 | 2330728 | - | NC_010814.1 | Geobacter lovleyi SZ |
| 2 | 2603554 | 2603781 | - | NC_008609.1 | Pelobacter propionicus DSM 2379 |
| 3 | 2161777 | 2162007 | - | NC_007517.1 | Geobacter metallireducens GS-15 |
| 4 | 2537866 | 2538096 | - | NC_009483.1 | Geobacter uraniireducens Rf4 |
| 5 | 3324064 | 3324291 | - | NZ_AP023213.1 | Citrifermentans bremense |
| 6 | 1453142 | 1453369 | + | NC_011146.1 | Citrifermentans bemidjiense Bem |
| 7 | 2891853 | 2892083 | + | NC_011979.1 | Geobacter daltonii FRC-32 |
| 8 | 1612856 | 1613086 | + | NZ_CP009788.1 | Geobacter pickeringii |
| 9 | 1928897 | 1929127 | - | NC_002939.5 | Geobacter sulfurreducens PCA |
| 10 | 1778222 | 1778440 | - | NZ_CP030840.1 | Acidisarcina polymorpha |
| 11 | 1751015 | 1751233 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 12 | 1972367 | 1972618 | - | NC_019977.1 | Methanomethylovorans hollandica DSM 15978 |
| 13 | 1164078 | 1164299 | + | NC_012483.1 | Acidobacterium capsulatum ATCC 51196 |
| 14 | 3200899 | 3201120 | - | NZ_CP018099.1 | Caldithrix abyssi DSM 13497 |
| 15 | 2843285 | 2843533 | + | NZ_CP060084.1 | Teredinibacter haidensis |
| 16 | 5117002 | 5117247 | + | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 17 | 1275156 | 1275386 | - | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 18 | 719611 | 719856 | - | NZ_CP068034.2 | Pseudomonas syringae |
| 19 | 627239 | 627484 | - | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 20 | 753503 | 753748 | - | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 21 | 2486332 | 2486520 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 22 | 2142425 | 2142634 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 23 | 170531 | 170731 | - | NZ_CP053562.1 | Thioclava electrotropha |
| Neighborhood Conservation Analysis |
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13292.8 | 0.74 | 17 | 940 | same-strand | 1-deoxy-D-xylulose-5-phosphate synthase |
| 2 | PF02779.26 | 0.74 | 17 | 940 | same-strand | Transketolase, pyrimidine binding domain |
| 3 | PF02780.22 | 0.74 | 17 | 940 | same-strand | Transketolase, C-terminal domain |
| 4 | PF00348.19 | 0.83 | 19 | 6 | same-strand | Polyprenyl synthetase |