Result : EXP01935

Protein Information

• Protein name: EXP01935
• NCBI Accession ID: NC_000962.3
• Organism: Mycobacterium tuberculosis H37Rv
• Left: 2006560
• Right: 2006655
• Strand: +
• Nucleotide Sequence: ATGCGCGTTGGGAGCCACCGTCGCGAACCAAGCGTGCGCGTTCACGGATTCGTCCGCCTGAGTTGGCGGATATCGGTTGGGTTCAACAGGAGGTAG
• Sequence: MRVGSHRREPSVRVHGFVRLSWRISVGFNRR
• Source of smORF: Transcriptional-level
• Pubmed ID: 26536359
• Functional Category: Function not yet assigned
• ORF Length (Amino Acid): 31

Conservation Analysis

No. of Species: 3

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	2049509	2049604	+	NC_015848.1	Mycobacterium canettii CIPT 140010059
2	2006560	2006655	+	NC_000962.3	Mycobacterium tuberculosis H37Rv
3	3902589	3902693	-	NZ_CP033052.1	Bacillus vallismortis

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_015848.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF00934.22	0.67	2	4090.0	same-strand	PE family
2	PF01168.22	0.67	2	2690.0	same-strand	Alanine racemase, N-terminal domain
3	PF04389.19	0.67	2	1396.0	same-strand	Peptidase family M28
4	PF04030.16	0.67	2	113.0	same-strand	D-arabinono-1,4-lactone oxidase
5	PF01565.25	0.67	2	645.0	same-strand	FAD binding domain
6	PF03861.16	0.67	2	8.0	same-strand	ANTAR domain
7	PF01614.20	0.67	2	365.0	opposite-strand	Bacterial transcriptional regulator
8	PF09339.12	0.67	2	365.0	opposite-strand	IclR helix-turn-helix domain
9	PF18089.3	0.67	2	2517.0	same-strand	DAPG hydrolase PhiG domain
10	PF00440.25	0.67	2	3340.0	opposite-strand	Bacterial regulatory proteins, tetR family