Result : EXP01933
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | EXP01933 |
| NCBI Accession ID | NC_000962.3 |
| Organism | Mycobacterium tuberculosis H37Rv |
| Left | 1998936 |
| Right | 1999070 |
| Strand | + |
| Nucleotide Sequence | GTGCAGGCATTCCTGGTTGTACCAGCCAGCCATTCGGCGGTTGCCAGTTTGACGTCGTCGATGCACCGCCAGGGTCTGCCGCGGTTGATCAACTCGGACTTGGAGGCGACGTTGACCGCGAGGGCGTTGTCATAA |
| Sequence | VQAFLVVPASHSAVASLTSSMHRQGLPRLINSDLEATLTARALS |
| Source of smORF | Transcriptional-level |
| Function | |
| Pubmed ID | 26536359 |
| Domain | |
| Functional Category | Function not yet assigned |
| Uniprot ID | |
| ORF Length (Amino Acid) | 44 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2041867 | 2042001 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 2 | 3610920 | 3611045 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 3 | 2622057 | 2622182 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 4 | 2022250 | 2022375 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 5 | 1998936 | 1999070 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 6 | 3891872 | 3891997 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 7 | 3711475 | 3711600 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 8 | 3553806 | 3553931 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 9 | 3552323 | 3552448 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 10 | 2973202 | 2973327 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 11 | 1542088 | 1542213 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 12 | 2636670 | 2636795 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 13 | 2551107 | 2551232 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 14 | 1987839 | 1987964 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 15 | 2366507 | 2366632 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 16 | 1997194 | 1997319 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 17 | 2430253 | 2430378 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 18 | 2784751 | 2784876 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 19 | 3120660 | 3120785 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 20 | 890114 | 890239 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 21 | 3795194 | 3795319 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 22 | 2374282 | 2374407 | + | NZ_CP016172.1 | Bordetella flabilis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_015848.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00665.28 | 1.0 | 3 | -125 | opposite-strand | Integrase core domain |
| 2 | PF13683.8 | 1.0 | 3 | -125.0 | opposite-strand | Integrase core domain |
| 3 | PF13276.8 | 1.0 | 3 | -125 | opposite-strand | HTH-like domain |
| 4 | PF13333.8 | 0.67 | 2 | 1548.0 | opposite-strand | Integrase core domain |
| 5 | PF01527.22 | 1.0 | 3 | 716 | opposite-strand | Transposase |
| 6 | PF02720.19 | 0.67 | 2 | 420 | opposite-strand | Domain of unknown function (DUF222) |
| 7 | PF01844.25 | 0.67 | 2 | 420 | opposite-strand | HNH endonuclease |
| 8 | PF02583.19 | 0.67 | 2 | 667 | same-strand | Metal-sensitive transcriptional repressor |
| 9 | PF02627.22 | 0.67 | 2 | 974 | same-strand | Carboxymuconolactone decarboxylase family |
| 10 | PF00934.22 | 0.67 | 2 | 1706.5 | opposite-strand | PE family |
| 11 | PF01168.22 | 0.67 | 2 | 3616 | same-strand | Alanine racemase, N-terminal domain |
| 12 | PF01381.24 | 0.67 | 2 | 2670 | opposite-strand | Helix-turn-helix |
| 13 | PF13560.8 | 0.67 | 2 | 2670 | opposite-strand | Helix-turn-helix domain |
| 14 | PF08808.13 | 0.67 | 2 | 1165 | opposite-strand | RES domain |
| 15 | PF13384.8 | 0.67 | 2 | 1687.0 | same-strand | Homeodomain-like domain |
| 16 | PF13565.8 | 0.67 | 2 | 1687.0 | same-strand | Homeodomain-like domain |
| 17 | PF13518.8 | 0.67 | 2 | 1932.0 | both-strands | Helix-turn-helix domain |
| 18 | PF12697.9 | 0.67 | 2 | 1783.0 | both-strands | Alpha/beta hydrolase family |
| 19 | PF01494.21 | 0.67 | 2 | 6913.0 | same-strand | FAD binding domain |
| 20 | PF00823.21 | 0.67 | 2 | 2441.0 | opposite-strand | PPE family |
| 21 | PF01469.20 | 0.67 | 2 | 1765.5 | both-strands | Pentapeptide repeats (8 copies) |
| 22 | PF13810.8 | 0.67 | 2 | 1040.5 | opposite-strand | Domain of unknown function (DUF4185) |
| 23 | PF01083.24 | 0.67 | 2 | 4724.5 | same-strand | Cutinase |
| 24 | PF03992.18 | 0.67 | 2 | 2073.5 | opposite-strand | Antibiotic biosynthesis monooxygenase |
++ More..